KEGG   Methylobacterium radiotolerans: Mrad2831_5344Help
Entry
Mrad2831_5344     CDS       T00674                                 

Definition
(GenBank) hypothetical protein
Organism
mrd  Methylobacterium radiotolerans
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACB27291
UniProt: B1LYA7
Position
5653041..5653352
Genome map
AA seq 103 aa AA seqDB search
MHRATSRRTMKARRESCHGWSIETLSYSPTRIVRLGAEKVAILFPPVEPGAAWQLYPHPD
TFPGLNFEGLPEPLRPEFLAFPDLPEVERFLGIRDAEPVALAA
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgcgcgacgagccgccgcaccatgaaggcccgccgggagtcttgccacggctgg
agcatcgagacgctgtcctacagcccgacgcggatcgtccgcctcggcgccgagaaggtc
gcgatcctgttcccgccggtcgagcccggtgcggcctggcagctctacccgcatcccgac
acgttcccgggtctcaacttcgagggtctgcccgagccgctgcgcccggaattcctcgcc
ttcccggatcttccggaagtcgagcggttcctcggcatccgcgacgccgagcccgtcgcc
ctcgcggcgtga

DBGET integrated database retrieval system