KEGG   Methylobacterium radiotolerans: Mrad2831_5347Help
Entry
Mrad2831_5347     CDS       T00674                                 

Definition
(GenBank) Polyprenyl synthetase
  KO
K02523  octaprenyl-diphosphate synthase [EC:2.5.1.90]
Organism
mrd  Methylobacterium radiotolerans
Pathway
mrd00900  Terpenoid backbone biosynthesis
mrd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mrd00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mrad2831_5347
Enzymes [BR:mrd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.90  all-trans-octaprenyl-diphosphate synthase
     Mrad2831_5347
Prenyltransferases [BR:mrd01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   Mrad2831_5347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: ACB27294
UniProt: B1LYB0
Position
5654510..5655529
Genome map
AA seq 339 aa AA seqDB search
MALSIENPKPEAEAGLNDLVALVADGMARVNTTILSRTGSDVAMIPEVANHLIASGGKRL
RPILTLACAQLCGYAGATEGDVKLAASVEFMHTATLLHDDVVDESDMRRGRVAARIKWGN
EASVLVGDFLLGQAFRMMVEVGSLRALDILSAAATVIAEGEVMQLTNAKNLETDEAAYLA
VIRGKTAELFAAACEVGPVLAGRPEAEQAAARSYGMNLGIAFQLIDDVLDYGGTSAELGK
NVGDDFREGKITLPIVLAYRRASEGERGFWRRTLQQGEIGETDLETALDLLQRHGALEET
VARAHHYGAEARAALDIFPDGPVKAALIGAVEFCVARAR
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggccctctccatcgagaatccgaagcccgaggcggaggcggggctcaacgacctcgtc
gcgctggtggccgacggcatggcgcgggtcaacaccacgatcctgtcgcggacgggatcg
gacgtggcgatgatccccgaggtcgccaaccacctgatcgcctccggcggcaagcgcctg
cggccgatcctgacgctggcctgcgcgcagctctgcggctacgcgggcgccaccgaaggc
gacgtcaagctcgccgccagcgtcgagttcatgcacaccgccacgctcctccacgacgac
gtggtcgacgagagcgacatgcgccgcggccgcgtcgccgcccggatcaagtggggcaac
gaggcctccgtgctcgtcggcgacttcctgctcggccaagccttccggatgatggtcgag
gtcggctcgctgcgggcgctcgacatcctctcggccgccgccacggtgatcgccgagggc
gaggtgatgcagctcaccaacgccaagaacctggagaccgacgaggccgcctatctggcg
gtgatccgcggcaagaccgccgagctgttcgccgccgcctgcgaggtcgggccggtgctc
gccgggcgacccgaggccgagcaggcggcggcccgatcctacgggatgaatctcggcatc
gccttccagctgatcgacgacgtgctcgattacggcggcacctcggccgagctcggcaag
aacgtcggcgacgatttccgcgagggcaagatcaccctgccgatcgtcctggcctatcgc
cgggccagcgagggcgagcgcggcttctggcggcgcaccctgcagcagggcgagatcggc
gagaccgacctggagaccgccctcgacctcctacagcgccacggtgccctggaggagact
gtggcccgcgcccaccattacggcgccgaggcccgggccgccctcgacatcttcccggac
gggcccgtcaaggcggcgctgatcggggccgttgagttctgcgtggcgcgggcgcgctga

DBGET integrated database retrieval system