KEGG   Methylobacterium radiotolerans: Mrad2831_5349Help
Entry
Mrad2831_5349     CDS       T00674                                 

Definition
(GenBank) Chloride channel core
Organism
mrd  Methylobacterium radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Voltage_CLC CBS
Motif
Other DBs
NCBI-ProteinID: ACB27296
UniProt: B1LYB2
Position
5656163..5657980
Genome map
AA seq 605 aa AA seqDB search
MIGGTGSGSGEGSPSRRALGDFSADRRVLTLAGMAIVTGTAASGTAWILLTLIGLVTNLV
WYGRLDTALTSLAGAAPGPSMVAIPVIGALIVGAMARYGSEKIRGHGIPEAMEAILVGGS
RMSPRVAVLKPLSSAVAIGTGGPFGAEGPIIVTGGAVGSLFAQFFHLSAAERKTLLVAGA
AAGMTAIFGTPVAAVLLAVEVLLFEWRPRSLVPVTVGAVTAACWRPALFGAGPLFPFADN
PVLPWWGLPACALLGVACGLISGGLTRALYALEDGFGRLPLHWMWWPAIGAVVVGLGGLV
EPRALGVGYDVIHDLLSGHMLASAVVLILVVKAAIWLAALSSGTSGGVLAPLLILGGAVG
WLIGVLLPGAHGFWALIGMAAMLGGTLPAPLTGVVFAVEVTGDVAALAPLLAATVAAYAV
TVLLLKRSILTEKIARRGQHVTREYGIDPYDLARVEAVMTRTVETLDADLPLAEALAAIE
TGAHHAYPVVDGAGRPVGLVSRNDALRWTLEERDGAAEEGTLGERVSDADLAVVHPGDVV
SHALDVMLSAGQGRLPVTDPRTGGLVGLLTRKDLLQVRATVVRAEAERRAFYRKGRGERR
ARMEA
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgatcggcgggactgggagcggcagcggggagggcagcccgtcgcgccgggcgctgggg
gatttcagcgcggaccggcgggtcctgacgctggccggcatggcgatcgtcaccgggacc
gccgccagcggcaccgcctggatcctgctcacgctgatcggcctcgtcaccaatctcgtg
tggtacggccggctcgacaccgccctgacctccctggccggcgcggcgccggggccctcg
atggtggcgatcccggtgatcggggcgctgatcgtcggcgccatggcgcgctacggctcg
gagaagatccgcggccacgggatcccggaggcgatggaggcgatcctggtcggcggcagc
cggatgtcgcccagggtcgccgtgctcaagccgctctcctcggcggtcgcgatcggcacc
ggcggaccgttcggcgccgagggaccgatcatcgtgacgggcggcgcggtcggctcgctc
ttcgcccagttcttccatctcagcgccgccgagcggaagacgctgctggtggcgggcgcg
gcggcgggcatgaccgccatcttcgggacgcccgtggcggccgtgctgctcgccgtcgag
gttctgctgttcgagtggcggccgcggagcctcgtgccggtgaccgtcggggctgtcacc
gcggcctgctggcggccggccctgttcggcgccggcccgctctttcccttcgccgacaat
ccggtcctgccctggtgggggctgcccgcctgcgcgctgctcggcgtcgcctgcggcctc
atctcgggggggctgacccgggccctctacgcgctggaggacggcttcgggcggcttccc
ctgcactggatgtggtggcccgccatcggcgccgtcgtggtcgggctgggcggcctcgtg
gagccccgggcgctcggcgtcggctacgacgtcatccacgacctgctctccggccacatg
ctggcgagcgccgtcgtgctgatcctcgtggtcaaggcggcgatctggctcgccgccctg
tcgtcgggcacgtccggaggcgtgctcgcgccgctgctgatcctcggcggcgccgtcggc
tggctgatcggcgtcctcctgcccggcgcccacggtttctgggcgctcatcggcatggcg
gcgatgctcggcggcaccctgccggcgccgctgaccggcgtcgtcttcgccgtcgaggtg
accggcgacgtcgccgccctggcgccgctgctcgccgccaccgtggcggcctacgcggtg
accgtgctcctcctcaagcgctcgatcctgaccgagaagatcgcccggcgcgggcagcac
gtgacccgggaatacgggatcgatccctacgatctcgcccgggtcgaggcggtgatgacc
cgcacggtcgagaccctggacgcggacctgcccctggccgaggccctcgcggccatcgag
accggcgcccaccacgcctacccggtggtcgacggcgcgggccggcccgtcggcctcgtc
tcgcgcaacgacgccctccgctggaccctggaggagcgcgacggcgcggccgaggagggc
accctcggcgagcgcgtctcggacgccgatctcgccgtcgtccatccgggcgacgtggtc
tcgcacgccctcgacgtcatgctgtcggccgggcaggggcgcctgccggtcaccgatccg
cgcaccggcggcctcgtcgggctcctcacccgcaaggacctgctccaggtgcgcgccacg
gtggtgcgggccgaagccgagcgccgcgcgttctaccggaaggggcggggtgaaaggcgc
gcacggatggaagcatga

DBGET integrated database retrieval system