KEGG   Methylobacterium radiotolerans: Mrad2831_5354Help
Entry
Mrad2831_5354     CDS       T00674                                 

Definition
(GenBank) conserved hypothetical protein
Organism
mrd  Methylobacterium radiotolerans
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACB27301
UniProt: B1LYB7
Position
5662151..5663413
Genome map
AA seq 420 aa AA seqDB search
MRAVLSGRFAVILSGELTQSLFHFLLNILLVRALGAHDYGLFAIVFAVGAVGITYIRALV
AVPATIHVARSLGRPAALGYDVMFGSGAVLVSGIMAAAVGLVLIPVIGLGALAAGAFVGL
YAFRSYLRIVLLARGRPRIAGLSDLVYAVCGGLLVARWLNGEGTALLDRAFTAIALAHAT
AIAVAYAALRERIRFSLHARARARYRAIWRTLAWSLAGVTSLTVQGQGLTLLLALLAGPA
AYAPIAATIVLYAPLRIPASALLNMILPEISRLLAAGQVEAARRLVVRNGILLGSACLAY
GAVMAAALPLVEDILFKGRFAAQPMGWIGLGVWAVVTVSLLYAIPRAYLEASAAFRTITA
GAVASAALGMAVMVPALLLLPPATALVGLLASEVATLVWSVSAFRTLARHPGPARPLGTL
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccgtcctctcggggcggttcgccgtgatcctgtcgggcgagctgacccagagc
ctgttccacttcctcctgaacatcctgctggtgcgcgcgctcggcgcgcacgattacggc
ctgttcgccatcgtcttcgcggtcggggcggtcggcatcacctacatccgcgccctggtg
gcggtcccggcgacgatccacgtcgcccggagcctgggccggccggcggcgctcggctac
gacgtgatgttcggctcgggcgcggtgctggtctccggcatcatggcggccgccgtcggc
ctcgtcctgatcccggtgatcggcctcggcgccctcgcggccggggccttcgtgggcctc
tacgccttccgcagctacctgcggatcgttctcctcgcccgcggccggccccggatcgcc
ggcctgagcgacctggtctacgcggtctgcggcggtctcctcgtcgcgcgctggctgaac
ggagagggcacggcccttctcgatcgagccttcacggcgatagcgctcgcccacgcgacc
gcgatcgccgtggcctacgcggcgctgcgcgagcggatccgcttctcgctgcacgcgcgg
gcgcgcgcccgctaccgggcgatctggcggacgctggcgtggtcgctcgccggcgtcacc
agcctgaccgtgcagggtcagggcctgaccctgctgctggccctcctggccggtccggcc
gcctacgcgccgatcgccgccacgatcgtgctctacgcgccgctgcgcatccccgcgagc
gcgctgctgaacatgatcctgccggagatcagccggctgctcgcggccgggcaggtcgag
gccgcccgccggctcgtcgtccgcaacgggatcctgctcggcagcgcctgtctcgcctac
ggggcggtcatggccgcggccctgccgctcgtcgaggacatcctgttcaagggacggttc
gccgcgcagccgatgggctggatcgggctcggcgtctgggcggtggtgaccgtgtcgctg
ctctacgcgatcccgcgcgcctacctcgaggcctcggcggcgttccggaccatcacggcg
ggggcggtggcgagcgccgccctcggcatggccgtgatggtgccggcgctgctgctgctg
ccgcccgccaccgcgctcgtcggcctgctggcctccgaagtggcgacgctggtctggtcg
gtctcggccttccggacgctggcgcggcacccgggaccggcgcggcccctcggcaccctg
tga

DBGET integrated database retrieval system