KEGG   Methylobacterium radiotolerans: Mrad2831_5357Help
Entry
Mrad2831_5357     CDS       T00674                                 

Definition
(GenBank) Protein of unknown function DUF1972
Organism
mrd  Methylobacterium radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1972 Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 Glyco_trans_1_2
Motif
Other DBs
NCBI-ProteinID: ACB27304
UniProt: B1LYC0
Position
5666145..5667329
Genome map
AA seq 394 aa AA seqDB search
MPDRAPKLLILGTRGIPAAHGGFETFAERLALYLVERGWQVGVYCQRDVETVRDRIVRST
WNGVELITVEIGLRGPVATLAFDAICAHDAATRGGVCLVLGYNGAAFLPYLRARGGRILT
NMDGIEWRRPKWSLPVRAFFYVSEWIAAWSSQRLVADHPVIADHLARRRPRGAIATIPYG
GDPPAADVGPPPLGLAPDRYLVSIARIEPDNNILTLVEAFSRRARGVRLVVLGTLRVGNP
YHRAVEAAASPEVLFPGAIYEPEQVQALRVHARAYLHGHTVGGTNPSLVEALWAGNAVVA
HDNPFNRGTAGDAQFYFSDPDSCAAAIERVLSDGAAVAAARAAARARAEQFRWDAVLASY
EDALRRVGGYPPAPDRAARATAVAPVAAPAGPRW
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaccgcgcaccgaaactacttattctcggcacgcgcggtatcccggccgcccac
ggtggcttcgagactttcgcggaacgtctcgcgctctacttggtcgaacgcggctggcag
gtcggcgtgtactgccagagggatgtcgagacggtgcgggaccgcatcgtgcggagcacc
tggaacggcgtcgaactgatcaccgtggagatcggcctgcgcggtcccgtcgcgacgctc
gccttcgacgccatctgcgcccacgacgccgcgacccgcggcggcgtctgcctcgtgctc
ggctacaacggcgccgcgttcctgccctacctgcgggcgcggggcggacggatcctgacc
aacatggacgggatcgagtggcgccgtccgaaatggtcgctgcccgtgcgcgccttcttc
tacgtcagcgagtggatcgccgcgtggtcctcgcagcggctggtggccgaccatcccgtc
atcgccgaccacctcgcccgtcgcaggccgcgcggcgccatcgcgaccatcccgtacggc
ggcgatcccccggcggccgatgtcgggccgccgcccctcggcctcgcgccggaccgctac
ctcgtctcgatcgcccgcatcgagccggacaacaacatcctgacgctcgtcgaggccttc
tcgcgccgtgcccgcggcgtgcggctcgtggtgctcggcacgctgagggtcggcaacccg
taccatcgtgccgtagaggcggccgcctcgccggaggtgctgttccccggcgccatctac
gagcccgagcaggtccaggccctgcgggtccacgcgcgggcctatctccacggccacacg
gtgggcggcaccaacccgtcgctggtcgaggcgctctgggcgggcaacgccgtggtcgcc
cacgacaatccgttcaaccggggcacggccggggacgcgcagttctatttctcggatccg
gacagctgcgcggcggcgatcgagcgcgtgctctccgacggggccgcggtcgcggcggcc
cgcgcggcggcgcgggcgcgcgccgagcagttccgctgggacgccgtgctggcctcctac
gaggacgcgctgcgccgtgtcggcggctacccgccggcaccggaccgcgcggcgcgcgcc
accgcggtcgcgcccgtcgccgccccggccggtccgagatggtag

DBGET integrated database retrieval system