KEGG   Methylobacterium radiotolerans: Mrad2831_5359Help
Entry
Mrad2831_5359     CDS       T00674                                 

Definition
(GenBank) conserved hypothetical protein
Organism
mrd  Methylobacterium radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3927
Motif
Other DBs
NCBI-ProteinID: ACB27306
UniProt: B1LYC2
Position
complement(5668602..5669906)
Genome map
AA seq 434 aa AA seqDB search
MRTLRQTGFARRHDPAARTGPVLRALLRAESVALSVWALLLVGVSGGLLWVLGLNYEGIT
GSAASKIHPATYLAVVLIGWTLMRAGNPVIPVAGALNRRPASVLLAACGVLLLALIAARG
GAGLAGSIDTFVLAGLVPILLMDRDAATLGRLETIFHLVMLANALLGLFELASGQRFFPY
RFDGVAFESDTRSAALQGHPLANATMTACYILALAKGGGRLAPMPRAAMIVLQLVALVTF
GGRSATVTTLILGGAVGLVALNRTLRTGRVPLAAAACACFALTLLPVLVAVLAAAGFFDT
LLDRFVSDGGSAQARVDMLTVFDAIPFRQLLLAPDSLQVNTLRRIYGLEWGIENSIISAV
LYHGILVTGVLVIAVALYLAEIARDCRRGVWLPILAFVILVNTFEGLAGKTTLLAKFALM
LIVLFPPLPRRGRG
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
gtgaggaccctccggcagaccggcttcgcgcgccgccacgatccggcggcgcgcacgggt
ccggtgctgcgcgccctgctgcgggcggaatcggtggccctgtcggtctgggccctgctc
ctcgtcggggtctcgggcggcctcctgtgggtgctcggcctcaattacgaggggatcacc
ggctcggccgcctcgaagatccaccccgccacctacctggcggtcgtcctgatcggctgg
accctgatgcgcgcgggcaatccggtgatcccggtggccggggcgctcaaccggcggccg
gccagcgtgctcctggccgcctgcggcgtgctgctcctcgcgctgatcgcggcccggggc
ggcgcgggcctcgccggctccatcgacaccttcgtgctcgccggcctcgtcccgatcctc
ctgatggaccgggacgccgccacgctcgggcggctggagacgatcttccacctcgtgatg
ctcgccaacgccctgctcggcctgttcgagctcgcgagcggccagcgcttcttcccctac
cggttcgacggcgtggcgttcgagtccgacacgcggtcggcggccctccagggccacccg
ctggccaacgcgaccatgacggcgtgctacatcctggcgctggccaagggcggcggtcgc
ctcgcgccgatgccgcgcgccgccatgatcgttctccagctcgtcgccctggtcacgttc
ggaggacgctcggccaccgtcacgacgctgatcctcggcggcgctgtcgggctggtggcc
ctgaaccgcaccctgcgcaccggccgcgtcccgctggcggcggcggcctgcgcgtgcttc
gccctcaccctgctgccggttctggtcgccgtcctggccgcggccgggttcttcgacacc
ctgctggaccggttcgtctcggacggcggcagcgcgcaggcccgggtcgacatgctcacg
gtgttcgacgcgatcccgttccggcagctcctgctcgcgcccgactccctgcaggtgaac
acgctgcgccggatctacggcctggaatggggcatcgagaactcgatcatctcggccgtg
ctctaccacggcatcctggtcacgggggtgctggtgatcgcggtggcgctctacctcgcg
gagatcgcacgggattgccggcgcggcgtctggctgccgatcctggccttcgtgatcctc
gtgaacacgttcgagggcctcgccggcaagacgaccctgctcgccaagttcgccctgatg
ctgatcgtcctgttcccgcctctgccgcgccgcgggcgcggctga

DBGET integrated database retrieval system