KEGG   Methylobacterium radiotolerans: Mrad2831_5360Help
Entry
Mrad2831_5360     CDS       T00674                                 

Definition
(GenBank) lipopolysaccharide biosynthesis protein
Organism
mrd  Methylobacterium radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Wzz GNVR HTH_OrfB_IS605 OppC_N DUF1772
Motif
Other DBs
NCBI-ProteinID: ACB27307
UniProt: B1LYC3
Position
complement(5669903..5672008)
Genome map
AA seq 701 aa AA seqDB search
MAQIDHNIAVATWLGPVQPAHPERPGPNRPDTTAELGDLWRILWRRKRLVFGTALLLGLL
ALAYALITPSLYTATAQILIDPRDRQVVSNDVNPAGLSPDGGIAQVESQVKVIESDAVLG
RAVDQVGLATTPGFGAPRDGVVTRALGELRALVAGPKAERPVDARGRALDQLRRRLAVKR
ADKVFVIDLVVTTPDPDLSARIVNAIANAYLTDQTDARSDAAKRAAGELRGRLDELRSAV
NAADKKLEDYKARNGLIASSGRLVNEQQLTDLNARLVAARARTADAKARLQGIREARGQA
IGSGAMPEAVQSSVIERLRGQYAELAAKEADLRTNLGERHPFIAAVRAQMQDVRRLIDAE
LNRIAGAAETEAQRAQANERTLAAELERLQRQSAVNAQSSVQQRELEREVDAARSVYNAF
LVRAREIKEQTSIDSSNARIITTARPPQDPSWPPRLILVAAALAGGLGLGAGLALTREYL
APTVLSPRQLERLSNAPVVAVLPGLRPRGASASAASLTLDHLAATSGMSGHALALLVTSG
ESDEAERQAVIGLLAAVAVARGDRVLRVDADLRADGSGTGGLLDVLRGEQSLNAVTRTDP
ASGARRVGLGDTEKPLRDALTPANVERFIAGVKGRFDLVLVDGGVLTENLRLGPLAAAAD
RLLLVACNGATRQRDLIDLVDTSEALGRPISGSLLLTRRKA
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
gtggcacagatcgaccataacatcgctgtcgcgacgtggctcggcccggtgcagccggcg
catcccgagcgtccgggcccgaaccgtcccgacaccacggccgaactgggcgacctgtgg
cggatcctgtggcggcgcaagcggctggtcttcgggacggcgctgctgctcggcctcctc
gccctggcctacgcgctgatcacgccctcgctctacaccgccacggcgcagatcctgatc
gatccccgcgaccgccaggtcgtctcgaacgacgtcaatccggccggactgtcgccggac
ggcggtatcgcccaggtcgagagccaggtgaaggtgatcgagtcggacgccgtgctgggg
cgcgcggtcgatcaggtcggactcgcgaccacgccgggcttcggcgcgccgcgggacggc
gtcgtgacgcgggccctcggcgagctccgcgcgctggtggccgggccgaaggcggagcgg
cccgtcgacgcccgcggccgggcgctggaccagctgcggcggcgcctcgcggtcaagcgc
gccgacaaggtcttcgtcatcgacttggtggtcaccacgccggatcccgatctctcggcg
cggatcgtcaacgccatcgcgaacgcctacctgacggaccagaccgacgcccgctcggac
gccgccaagcgcgccgcgggcgagctgcgcggccgcctcgacgagctgcggagcgccgtc
aacgccgccgacaagaagctcgaggattacaaggcgcgcaacggcctgatcgcgtcgagc
ggccggctcgtgaacgagcagcagctcaccgacctgaacgcgcggctggtcgccgcgcgg
gcgcggaccgccgacgccaaggcgcgtctgcaggggatccgggaggcccgcgggcaggcg
atcgggtccggagcgatgccggaggcggtccagtcctcggtgatcgagcgcctgcgcggg
cagtacgcggagctcgccgccaaggaggccgacctgcgcaccaatctcggcgagcgccac
ccgttcatcgccgccgtgcgcgcgcagatgcaggacgtccgccggctgatcgacgccgag
ctgaaccgcatcgcgggcgcggccgagaccgaggcccagcgcgcccaggcgaacgagcgg
accctcgcggcggagctggagcgcctgcagcggcagtcggcggtgaacgcacagtcgtcg
gtgcagcagcgcgagctcgagcgcgaggtcgacgcggcgcgctccgtctacaacgccttc
ctcgtgcgcgcccgggagatcaaggaacagaccagcatcgacagctcgaacgcccggatc
atcaccacggcgcggccgccgcaggatccgagctggccgccgcggctgatcctggtcgcc
gccgccctcgcgggcggcctcggcctcggcgccggcctcgcgctgacgcgggaatatctc
gcgccgaccgtgctctcgccgcggcagctggagcggctgtcgaacgcccccgtggtggcc
gtgctgcccgggctgcggccgcggggcgcgagcgcgagcgccgcgagcctcaccctcgac
cacctggccgcgacctccggcatgagcggccacgcgctggcgctgctcgtcacttcgggg
gaatccgacgaggcggagcgccaagcggtgatcgggctgctcgccgcggtcgccgtcgcg
cgcggcgaccgcgtcctgcgcgtggacgccgacctgcgggcggacggctccggcaccggc
ggcctcctcgacgtgctccgcggcgagcagagcctcaacgccgtgacccggacggacccg
gcctccggcgcccgccgggtcgggctcggcgacaccgagaagcccctgcgcgacgccctg
acacccgccaatgtcgagcgcttcatcgcgggcgtgaagggacgcttcgacctcgtgctc
gtcgacggcggcgtgctgaccgagaacctgcggctcggtcccctggcggccgccgccgac
cggctgctgctcgtcgcctgcaacggcgcgacgcgccagcgcgacctgatcgacctcgtc
gacacgtcggaggcgctgggccgaccgatttccggctctttactcctgacccggcgcaag
gcgtga

DBGET integrated database retrieval system