KEGG   Methylobacterium radiotolerans: Mrad2831_5362Help
Entry
Mrad2831_5362     CDS       T00674                                 

Definition
(GenBank) 5-formyltetrahydrofolate cyclo-ligase
  KO
K01934  5-formyltetrahydrofolate cyclo-ligase [EC:6.3.3.2]
Organism
mrd  Methylobacterium radiotolerans
Pathway
mrd00670  One carbon pool by folate
mrd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mrd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Mrad2831_5362
Enzymes [BR:mrd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.3  Cyclo-ligases
    6.3.3.2  5-formyltetrahydrofolate cyclo-ligase
     Mrad2831_5362
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 5-FTHF_cyc-lig
Motif
Other DBs
NCBI-ProteinID: ACB27309
UniProt: B1LYC5
Position
5672887..5673504
Genome map
AA seq 205 aa AA seqDB search
MAPHPTPPRTGAEAPDAARKAELRAAALAARDALDPAARQAASTAIGDALLALPELARAR
LVGAFWPIRSEVDPRPAAEGLRARGQAVALPHVTPDGLVFREWRAGDALVAGRFGLSEPD
PSLPPVEPDALIVPLAAFDRTGQRIGYGRGYYDGAIARLSRTRPVLTVGIGFAAQEVGRV
PAEPHDRPLQFVITEDGVIRCDRTA
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
gtggctccgcacccgacccctcccagaaccggcgccgaggctcccgacgccgcccgcaag
gcggaactccgcgccgcggccctcgccgcccgcgacgccctcgatccggcggcccgtcag
gcggcctcgacggcgatcggggacgcgctcctcgcgctgccggagctcgcccgggccaga
ctggtgggcgccttctggccgatccgcagcgaggtcgatccccggcccgccgccgagggc
ctacgcgcccgcggccaggccgtggccctgccgcacgtcacgccggacggcctggtgttc
cgggaatggcgcgccggcgacgccctcgtcgccggccggttcggcctcagcgagcccgac
ccgtcgctgccgccggtggagcccgacgcgctgatcgtgccgctcgccgccttcgaccgg
accgggcagcgcatcggttacggccggggctactacgacggcgcgatcgcgcgcctgtcc
cggacacgccccgtcctgaccgtcggcatcggcttcgccgcccaggaggtggggcgcgtg
ccggccgagccgcacgaccgccccctccagttcgtgatcaccgaagacggcgtgatccgc
tgcgacaggaccgcctga

DBGET integrated database retrieval system