KEGG   Methylobacterium radiotolerans: Mrad2831_5363Help
Entry
Mrad2831_5363     CDS       T00674                                 

Definition
(GenBank) metallophosphoesterase
  KO
K09769  uncharacterized protein
Organism
mrd  Methylobacterium radiotolerans
Brite
KEGG Orthology (KO) [BR:mrd00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Mrad2831_5363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YmdB
Motif
Other DBs
NCBI-ProteinID: ACB27310
UniProt: B1LYC6
Position
5673508..5674326
Genome map
AA seq 272 aa AA seqDB search
MRLLFLGDVVGRSGRTVVCEHLPRLRERWRLDCVVVNGENAAGGFGISETICDELIQAGA
DAVTLGNHSFDQREAMVFIARQPRLVRPANYPPGTPGRGATVVETQGGARVLVVNVMGRV
FLDAMDDPFAAVERELTACPLGAAADAVIVDVHAEATSEKQAFGHYLDGRASLVVGTHTH
TPTADHRILPGGTAYMSDAGMCGDYDSVIGMQKDEPIRRMIQKTPGSRWEVAVGEGTLCG
IAVETDARGLATRVAALRLGPNLEETAPHFWD
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctgctcttcctcggcgacgtcgtcgggcgttcgggccgcaccgtggtgtgcgag
cacctgccgcgcctccgggagcgttggcgcctcgactgcgtggtggtcaacggcgagaat
gcggccggcggcttcggcatctccgagaccatctgcgacgagctgatccaggccggcgcc
gacgcggtcaccctcggcaaccacagtttcgaccagcgcgaggcgatggtgttcatcgcc
cgccagccgcgcctcgtgcggccggcgaactatccgcccggcacgccgggccgcggcgcc
acggtggtggagacccagggcggcgcccgcgtgctcgtggtcaacgtgatgggccgcgtc
ttcctcgacgcgatggatgatcccttcgcggcggtcgagcgcgagctcaccgcctgcccc
ctcggcgcggcggcggacgcggtcatcgtcgacgtccacgccgaggcgacgagcgagaag
caggccttcggccactatctcgacggccgggcgagcctcgtcgtcgggacgcacacgcac
acgcccacggcggatcaccggatcctgcccggcggcacggcctacatgtcggatgccggc
atgtgcggcgattacgattcggtgatcggcatgcagaaggacgagccgatccgccgcatg
atccagaagacgccgggctcccgctgggaggtcgccgtcggcgaggggaccctgtgcggc
atcgcggtggagacggacgcgcgcggcctcgccacgcgggtcgcggccctccggctggga
ccgaatctcgaggagacagcgccgcatttctgggattag

DBGET integrated database retrieval system