KEGG   Methylobacterium radiotolerans: Mrad2831_5364Help
Entry
Mrad2831_5364     CDS       T00674                                 

Definition
(GenBank) conserved hypothetical protein
Organism
mrd  Methylobacterium radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MotA_ExbB Hemerythrin DUF3035
Motif
Other DBs
NCBI-ProteinID: ACB27311
UniProt: B1LYC7
Position
5674533..5675519
Genome map
AA seq 328 aa AA seqDB search
MAARQTGDDKNGPLAQPGIYLGRMVIFLILVGFLAFILFRQITPAFLANPGLNGLILGVL
LIAVLIAFGQVVRLFRETAYVNAVASGAQVKRPPALLAPMAPMIAARAGGTTLPGTTGYL
DTIAVRLDEGREILRYIAGILILLGLLGTFWGLIDTLSAVGGVIKGMRGGGDAGVMFDEL
KSGLAVPLSGIGLAFSASLFGLASSLITGFLELQAGQAHARFHNELQDWLMSGAASQEAA
PVAAAAGARPAAGTQELKEAVDRLSALVAEGGGSRAATQAMTNLAEGIQGLVQHMRAEQQ
MIRDWVEAQASRERELKQVLDRLGRERV
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggccgcccgacaaaccggcgacgacaagaatgggccgctggcacagcccgggatctat
ctcgggcgcatggtcatcttcctgatcctcgtaggcttcctcgccttcatcctgttccgg
cagatcacaccggccttcctggccaatcccgggctcaacgggctgatcctcggtgttctg
ctgatcgccgtcctgatcgccttcgggcaggtcgtccggctgttccgcgagaccgcctac
gtcaacgccgtcgccagcggcgcgcaggtcaagcggccgcccgccctgctggcgccgatg
gcgccgatgatcgccgcgcgggccggcgggacgaccctgcccggcacgaccggctatctc
gacacgatcgcggtgcgcctcgacgagggccgcgagatcctgcgctacatcgccgggatc
ctgatcctgctcggcctgctcggcaccttctggggcctcatcgacacgctgtcggcggtc
ggcggcgtcatcaagggcatgcgcggcggcggcgatgccggcgtcatgttcgacgagctg
aaatccggcctcgcggtgccgctctcgggcatcggtctggcgttctcggcctcgctgttc
ggcctcgcctcgtcgctgatcaccggcttcctggaattgcaggcgggccaggctcatgcc
cggttccacaacgaactgcaggactggttgatgtccggcgcggcttcccaggaggcggcg
ccggtcgcggcggcggccggtgccaggccggccgccgggactcaagagctgaaggaggcg
gtcgaccgcctgagtgccctggtggccgagggcggcggcagccgcgcggcgacgcaggcg
atgaccaacctcgccgagggcatccagggcctcgtccagcacatgcgcgccgagcagcag
atgatccgcgactgggtggaggcgcaggcgagccgcgagcgcgagctgaagcaggtgctc
gaccggctgggccgggagcgcgtctag

DBGET integrated database retrieval system