KEGG   Methylobacterium radiotolerans: Mrad2831_5376Help
Entry
Mrad2831_5376     CDS       T00674                                 

Definition
(GenBank) conserved hypothetical protein
Organism
mrd  Methylobacterium radiotolerans
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACB27323
UniProt: B1LYD9
Position
5687435..5687638
Genome map
AA seq 67 aa AA seqDB search
MANPGLPEPTPGDLPPPPPTPEEEPDIGPTGPRTPYPVNDPGIGEPGGPGSEPDIFPGTP
TDPGTRM
NT seq 204 nt NT seq  +upstreamnt  +downstreamnt
atggccaatcccggccttcccgagcccacgcccggcgacctgccgccgcccccgccgacg
cccgaagaggagcccgatatcggcccgaccggcccgcgcacgccctacccggtcaacgac
ccgggcatcggagaacccggcggtccgggctcagagccggacatcttccccggcacgccg
acggatcccggcacgcgcatgtga

DBGET integrated database retrieval system