KEGG   Methylobacterium radiotolerans: Mrad2831_5377Help
Entry
Mrad2831_5377     CDS       T00674                                 

Definition
(GenBank) conserved hypothetical protein
Organism
mrd  Methylobacterium radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3090
Motif
Other DBs
NCBI-ProteinID: ACB27324
UniProt: B1LYE0
Position
complement(5687675..5688064)
Genome map
AA seq 129 aa AA seqDB search
MAGISVSLDGANIQLSFQKDDQATAVVMDARAARALVRAVGQLLTAIDDTDEPDMADEMG
DEEVAMLDVTSSAIEIGTDDEGQAVVALQAGALPPFQLRLTDEEARHVVTSLSEILNAPR
DVRTSHGGH
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcatctcggtctcgctggacggtgcgaacatccagctctccttccagaaggac
gatcaggcgacggcggtggtgatggatgcccgcgccgcccgggcgctggtgcgcgccgtc
gggcaactcctcacggcgatcgacgatacggacgagcccgacatggccgacgagatgggc
gacgaggaggtcgccatgctcgacgtgacgtcgtccgccatcgagatcggcaccgacgac
gagggccaagcggtggtcgccctgcaggccggcgctcttccgccgttccagctccgcctc
acggacgaagaggcccgccacgtcgtgacgagcctctccgagatcctcaacgctccgcgc
gacgtgcggacctcgcacggcggccactga

DBGET integrated database retrieval system