KEGG   Methylobacterium radiotolerans: Mrad2831_5391Help
Entry
Mrad2831_5391     CDS       T00674                                 

Definition
(GenBank) glycosyl transferase group 1
Organism
mrd  Methylobacterium radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_trans_1_4 Glycos_transf_1
Motif
Other DBs
NCBI-ProteinID: ACB27338
UniProt: B1LYF4
Position
complement(5698969..5700096)
Genome map
AA seq 375 aa AA seqDB search
MTASGADAGGARAAPGRRRIYLDQTHLRDHVTGIERVTLDLFAPDRLAPHAVRPVTAGSL
PGMIAAQQLGLPARALTDRDALFLFPGFPPGPLCAVAASRCLLYVHDTFLLTRKEDLSLR
SRLYMSPSFALALRWCPNLFVNSRTTGADVRALCARRARVALLRPPVRDAFGLEDLPGPA
AYAPGRTLRILAIGTIEPRKNYPATLALTAALIRAGIPAELHLVGRVGWGRHAFLEAPPP
FLHRHGYLTDAELRALAGSCHLLLSTSKAEGLGLPLLEVQHGGLPVVAPDDPVFREVLGG
SALLIRPEQPDAAACALAGWIRDGALARAAGMSRANVARWNAAAAEDGARFQRFLAGDPA
AYDALESIVAHEGDG
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
gtgacggcgagcggcgcagatgcgggcggcgcgcgggcggcgccggggcggcggcggatc
tacctcgatcagacccatctgcgcgaccacgtaacggggatcgagcgggtcaccctcgac
ctgttcgctcccgaccggctcgccccgcacgcggtgcggccggtgaccgcgggctccctg
cccggcatgatcgccgcgcagcagctcggactgccggcgcgggcgctgacggatcgggac
gccctgttcctgttcccgggcttcccgcccgggccgctctgcgccgtcgcggcgtcgcgc
tgcctgctctacgtccacgacaccttcctgctcacgcggaaggaggatctgagcctgcgc
agccggctctacatgagcccgagcttcgccctggccctgcgctggtgcccgaacctgttc
gtcaacagccgcaccaccggggcggacgtgcgcgcgctctgtgccaggcgcgcccgcgtc
gcgctgctgcggccgcccgtccgcgacgccttcggcctggaggacctgcccggaccggcg
gcctacgcgccgggccggacgctgcggatcctggccatcggcaccatcgagccgcgcaag
aactatccggcgaccctcgcgctgacggcggcgctgatccgcgccggcatcccggcggaa
ctccatctcgtcggccgggtcggctgggggcggcacgccttcctggaggcaccgccgccg
ttcctgcaccgccacggatacctcaccgacgccgaactgcgcgccctcgcgggctcgtgc
cacctgctgctctccacctccaaggcggaggggctcggcctgccgctgctggaggtgcag
cacggcggcctgccggtggtggcgccggacgacccggtcttccgcgaggtgctgggcggg
tcggccctgctgatccggccggagcagcccgacgcggccgcgtgcgccctcgccgggtgg
atccgcgacggcgccctggcccgcgccgccgggatgagtcgggccaacgtcgcgcgctgg
aacgcggccgcggccgaggacggggcgcgcttccagcgcttcctggccggcgatcccgcg
gcctacgatgcgctggagtcaattgtcgcacacgagggcgatggctga

DBGET integrated database retrieval system