KEGG   Methylobacterium radiotolerans: Mrad2831_5393Help
Entry
Mrad2831_5393     CDS       T00674                                 

Definition
(GenBank) selenide, water dikinase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
mrd  Methylobacterium radiotolerans
Pathway
mrd00450  Selenocompound metabolism
mrd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mrd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Mrad2831_5393
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mrd03016]
    Mrad2831_5393
Enzymes [BR:mrd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     Mrad2831_5393
Transfer RNA biogenesis [BR:mrd03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    Mrad2831_5393
 Prokaryotic Type
    Mrad2831_5393
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS Dyp_perox
Motif
Other DBs
NCBI-ProteinID: ACB27340
UniProt: B1LYF6
Position
complement(5702186..5703232)
Genome map
AA seq 348 aa AA seqDB search
MSDAPRLTSLAHGGGCGCKLDPATLRQLLAQQPAAGPFERLLVGNETADDAAVWELEDGT
CLIATTDFFTPMVDDPVDFGRIAATNAISDVYAMGGRPLFALAILGMPLGKIDPEVVARI
LRGGAEQCAEAGIPVAGGHSIDAPEPIYGLAVIGTCRREAVRRNADAVAGDAVLLTKALG
VGVYSAAIKRATLDEAGYRDFIATTTLLNRIGTDLAADPAVHALTDVTGFGILGHGLEIA
RGAGLTLALEADALPLLPQAEALARAGAVTGASHRNWAAFGEAVDLPADLPEWRRHLLTD
PQTSGGLLVTCSADRADAILARVRAAGYPAAARIGRIEPGPARIRVAA
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatgccccccgcctgaccagtctcgcccacggaggcggatgcggctgcaagctc
gacccggccaccctgcgccagctcctcgcccagcagccggcggcgggcccgttcgagcgg
ctcctcgtcggcaacgagaccgcggacgacgcggcggtgtgggagctggaggacggcacc
tgcctcatcgccaccacggacttcttcaccccgatggtggacgaccccgtcgatttcggc
cggatcgccgcgacgaacgccatctcggacgtctacgccatgggcggccggccgctcttc
gcgctggcgatcctcgggatgccgctgggcaagatcgacccggaggtggtcgcgcggatc
ctgcgcggcggcgcggagcaatgcgccgaggccggcatcccggtcgcgggcggccactcg
atcgacgcgccggagccgatctacggtctcgcggtgatcggaacctgccgccgcgaggcg
gtgcggcgcaacgccgacgcggtggccggcgacgccgtcctgctcaccaaggctctcggg
gtcggggtctactcggcggcgatcaagcgggcgaccctcgacgaggccggctaccgcgac
ttcatcgcgaccacgacgctgctcaaccggatcggaaccgacctcgccgccgatcccgcc
gtgcacgccctcaccgacgtcaccggcttcggcatcctcgggcacggcctggagatcgcc
cgcggcgccggcctcacgctcgccctcgaggccgacgccctcccgctgctgccgcaggcg
gaggcgctggcgcgcgccggcgccgtcaccggcgcctcgcaccgcaactgggcggcgttc
ggcgaggcggtggacctgcccgccgacctccccgagtggcgccgccacctcctgaccgac
ccgcagacctcgggcggcctgctggtgacctgctcggccgaccgcgccgacgcgatcctg
gcgcgcgtccgggcggccggttacccggcggccgcccggatcggccggatcgagcccggc
ccggcacggatccgcgtggcggcctga

DBGET integrated database retrieval system