KEGG   Methylobacterium radiotolerans: Mrad2831_5399Help
Entry
Mrad2831_5399     CDS       T00674                                 

Definition
(GenBank) flagellar FlaF family protein
  KO
K06602  flagellar protein FlaF
Organism
mrd  Methylobacterium radiotolerans
Brite
Bacterial motility proteins [BR:mrd02035]
 Flagellar system
  Flagellar assembly proteins
   Rod,hook and filament
    Mrad2831_5399
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FlaF
Motif
Other DBs
NCBI-ProteinID: ACB27346
UniProt: B1LYG2
Position
5705831..5706202
Genome map
AA seq 123 aa AA seqDB search
MNYAANAYAKTSHSALSPREAESAVLLKAAQKLIGASQGLASGDAGRINEALTFNQRVWT
LLTSEATSDVNPLPADVKQGVGRLGVFVLQSCIDTMIAPTPEKIATLVSINNHIAAGLQG
NPG
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgaactacgccgccaacgcctacgccaagacttcccacagcgcgctgtcgccccgcgag
gccgaatccgccgtgctgttgaaggccgcacagaagctcatcggcgccagtcaggggctc
gccagcggcgatgccggacgcatcaacgaggccctgacgttcaaccagcgggtctggacg
ctgctgacctccgaggcgacgtccgacgtgaacccgctccccgccgacgtgaagcagggc
gtcggccgcctgggcgtgttcgtgctccagagctgcatcgacaccatgatcgcgccgacg
cccgagaagatcgccacgctggtgtcgatcaacaatcacatcgccgccggtcttcagggc
aatcccggctga

DBGET integrated database retrieval system