KEGG   Methylobacterium radiotolerans: Mrad2831_5401Help
Entry
Mrad2831_5401     CDS       T00674                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K22185  D-xylose 1-dehydrogenase [EC:1.1.1.175]
Organism
mrd  Methylobacterium radiotolerans
Pathway
mrd00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:mrd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Mrad2831_5401
Enzymes [BR:mrd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.175  D-xylose 1-dehydrogenase
     Mrad2831_5401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase DUF1776 GDP_Man_Dehyd 3HCDH_N MlrC_C AdoHcyase_NAD
Motif
Other DBs
NCBI-ProteinID: ACB27348
UniProt: B1LYG4
Position
5706782..5707558
Genome map
AA seq 258 aa AA seqDB search
MAAQPDQRARYPSLAGKRVLVTGGASGIGAGLVEAFVGQGARVLFCDIADDAARAVVARL
GPGAAHAPLYRRCDLTDVDAVRALVAEADAALGGLDVLINNAGNDDRHALADVTPAYWDD
RMAVNLRHLFFAAQAAVPAMQRAGGGVILNFGSISWHLGLREMPLYQTAKAAIEGMTRAL
ARDLGRDNIRVATVVPGNVQTPRQERWYTPEGEAEIVAAQCLDGRIQPADVAALVLFLAS
DDARMCTGHPYFIDAGWR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcagccggatcagcgcgcgcggtatccgagcctcgccggcaagcgcgtcctc
gtgaccggcggcgcctcgggcatcggcgcggggctggtcgaggccttcgtcgggcagggg
gcccgcgtcctgttctgcgatatcgcggacgatgcggcccgcgccgtggtggcccgtctc
gggcccggcgccgcgcacgccccgctctaccggcgctgcgacctgaccgatgtcgacgcg
gtccgcgcgctggtcgccgaggccgacgcggccctgggcgggctcgacgtcctgatcaac
aatgccggcaacgacgaccgccacgccctcgcggacgtgacgcccgcctactgggacgac
cggatggcggtgaacctgcgccacctgttcttcgccgcccaggcggcggtcccggccatg
cagcgcgccggcggcggcgtgatcctcaacttcggatcgatcagctggcatctcgggctc
agggagatgccgctctaccagaccgccaaggcggcgatcgaggggatgacacgcgccctg
gcccgcgacctcggtcgcgacaacatccgggtggcgacggtcgtgcccggcaacgttcag
acgccccgccaggagcgatggtacacgccggagggcgaggcggagatcgtcgccgcgcaa
tgcctcgacgggcggatccagccggccgacgtcgccgcgctggtcctgttcctggcctcg
gacgacgcgcgcatgtgcaccggccacccgtacttcatcgacgcgggctggcgctga

DBGET integrated database retrieval system