KEGG   Methylobacterium radiotolerans: Mrad2831_5403Help
Entry
Mrad2831_5403     CDS       T00674                                 

Definition
(GenBank) molybdopterin converting factor, subunit 1
  KO
K03636  sulfur-carrier protein
Organism
mrd  Methylobacterium radiotolerans
Pathway
mrd04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:mrd00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    Mrad2831_5403
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ThiS
Motif
Other DBs
NCBI-ProteinID: ACB27350
UniProt: B1LYG6
Position
complement(5708077..5708328)
Genome map
AA seq 83 aa AA seqDB search
MKLVYFAWVRERIGRSEEELAPPPEVATVADLVGWLRGRGEEYAYAFEDPGVVRAAIDRA
HVKPDAPIAGAREIAFFPPMTGG
NT seq 252 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcgtctatttcgcctgggtccgcgagcggatcggccgctccgaggaggagctg
gcgccgccgccggaggtcgccaccgtcgccgatctggtcgggtggctccgcggccgcggc
gaggagtacgcctacgccttcgaggatccgggcgtcgtccgcgccgcgatcgaccgggcc
catgtcaagccggacgcgccgatcgcgggtgcccgcgagatcgccttcttcccgccgatg
acgggcggctga

DBGET integrated database retrieval system