KEGG   Methylobacterium radiotolerans: Mrad2831_5404Help
Entry
Mrad2831_5404     CDS       T00674                                 

Definition
(GenBank) CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase
  KO
K08744  cardiolipin synthase (CMP-forming) [EC:2.7.8.41]
Organism
mrd  Methylobacterium radiotolerans
Pathway
mrd00564  Glycerophospholipid metabolism
mrd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mrd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Mrad2831_5404
Enzymes [BR:mrd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.41  cardiolipin synthase (CMP-forming)
     Mrad2831_5404
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CDP-OH_P_transf
Motif
Other DBs
NCBI-ProteinID: ACB27351
UniProt: B1LYG7
Position
complement(5708383..5708982)
Genome map
AA seq 199 aa AA seqDB search
MNAVLPRRRSPAWTLANCLTYGRLVAVPVMVALLFWPESHTARWTALGVFVAAAITDYLD
GYVARTYHQSSALGRMLDPIADKLLVSACLLMLAADHTIVGSNIWAAIVILCREVLVSGL
REYLAELKVGVPVSRIAKWKTTVQLLALGFLVAGPAGETVLPGTEAIGLTLLWLAAALTL
WTGWDYMRAGIKHVIDDPR
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccgtccttccccgacgacggtcgccggcctggacgctcgcgaattgcctgacc
tacgggcgcctcgttgccgtgccggtgatggtcgcgctgctgttctggcccgaatcccac
acggcgcggtggacggcgctgggggtgttcgtcgcggccgcgatcaccgactatctcgac
ggctacgtcgcccgcacctaccaccagagctcggcgctcggccggatgctcgatccgatc
gccgacaagctcctcgtctcggcctgcctgctgatgctggcggcggaccacaccatcgtc
ggctcgaacatctgggcggcgatcgtgatcctgtgccgcgaggtgctggtctccggcctg
cgcgagtatctggcggagctgaaggtcggcgtgccggtcagtcggatcgccaagtggaag
accaccgtgcagctcctggcgctcggcttcctggtggccggcccggcgggcgagacggtg
ctcccgggaaccgaggcgatcggcctgacgctcctgtggctcgccgccgcgctcacgctg
tggaccggctgggactacatgcgggccgggatcaagcacgtcatcgacgatccgcgctga

DBGET integrated database retrieval system