KEGG   Methylobacterium radiotolerans: Mrad2831_5407Help
Entry
Mrad2831_5407     CDS       T00674                                 

Definition
(GenBank) ErfK/YbiS/YcfS/YnhG family protein
Organism
mrd  Methylobacterium radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YkuD
Motif
Other DBs
NCBI-ProteinID: ACB27354
UniProt: B1LYH0
Position
5712191..5713000
Genome map
AA seq 269 aa AA seqDB search
MRRSVRLGMGVAAAAFVLCGPARAQQARYAEGGYGGGLIEYLVTGSAGGAGRGWPQRAAP
QQRVAAYSGELVPVEPEPAQAYGQAYGQAYGQPYSAPQPYGAPPAAASGAPQADPGRIGR
AVPPEYQRQEVAFAGRQKPGTIVIDTAGKHLYLVQAGQRALRYGIGVGRPGFAWSGLKTV
SRKAEWPDWTPPAEMLARRPDLPRHMAGGPENPLGARALYLGSSLYRIHGTNEPNTIGQS
VSSGCIRMMNDDVIDLYDRVPVGTRVEVL
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgttcagtccgtctgggaatgggggtggctgcggccgcgttcgtgctgtgcggc
cccgcccgggcgcagcaggcgcgctacgccgagggcggctacggcggcggcctcatcgag
tacctcgtcaccggcagcgccggcggcgccgggcgcggctggccgcagcgcgccgcgccg
cagcagcgggtcgccgcctattccggcgagctggtgccggtcgagccggagcctgcccaa
gcttacgggcaggcgtacgggcaggcgtacgggcagccctacagtgccccgcagccctac
ggcgcgccgcccgcggccgcctccggtgcgccccaggcggatccggggcggatcggccgc
gcagtcccgcccgagtatcagcgccaggaagtcgccttcgcggggcggcagaagcccggc
acgatcgtgatcgacaccgccggcaagcatctctacctcgtgcaggcggggcagcgcgcg
ctgcgctacgggatcggcgtcggccgccccggcttcgcctggagcggtctcaagacggtc
agccgcaaggcggagtggccggactggacgccgccggccgagatgctcgcccgtcgtccc
gatctgccgcgccacatggccggcggcccggagaacccgctgggcgcccgcgccctctac
ctcggctcgtcgctctaccgcatccacgggacgaacgagcccaacacgatcgggcagtcg
gtctcgtcgggctgcattcggatgatgaacgacgacgtcatcgacctctacgaccgcgtg
ccggtcggaacccgggtcgaggtcctctga

DBGET integrated database retrieval system