KEGG   Methylobacterium radiotolerans: Mrad2831_5409Help
Entry
Mrad2831_5409     CDS       T00674                                 

Definition
(GenBank) porin
  KO
K16079  outer membrane immunogenic protein
Organism
mrd  Methylobacterium radiotolerans
Brite
KEGG Orthology (KO) [BR:mrd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mrd02000]
    Mrad2831_5409
Transporters [BR:mrd02000]
 Other Transporters
  Pores ion channels [TC:1]
   Mrad2831_5409
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACB27356
UniProt: B1LYH2
Position
complement(5714053..5714892)
Genome map
AA seq 279 aa AA seqDB search
MKSMLRVTTALAGVAFAGSAFAADLPRRAAPPPVFTPVPVFTWTGAYFGINAGYAFDASD
RNTGNTFAVPFPYAAPGTVASFRNRSQDGFSGGGQIGYNWQITPGSGVVIGVEADAQYLD
FGRNRNNAFVSGAVAPGYYLTDPRGLSSLDFFGTVRGRLGYAFDRTLVYGTGGFAYGSGS
ADRSFGGYAGNDSFRTGWAAGGGIEYALPTDSFLNFFRSSAVTLKVEGLYVNLDRNTRNQ
GAFVINAANNFPVVYSGVGRRDDQFAVVRAGLNYKFGTF
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaaatccatgctccgtgtgaccacggccctcgcgggcgtcgccttcgccggctcggcc
ttcgcggccgacctgccgcgccgcgccgccccgccgccggtgttcacccccgtcccggtc
ttcacctggaccggcgcctacttcggtatcaacgccggctacgccttcgacgccagcgac
cgcaacaccggcaacaccttcgcggtgcccttcccctacgccgcccccggcaccgtcgcc
tccttccgcaaccgcagccaggacggcttctccggcggtggccagatcggctacaactgg
cagatcaccccgggctccggcgtcgtgatcggcgtcgaggccgacgcccagtacctcgac
ttcggccgcaaccggaacaacgccttcgtctccggcgccgtcgcccccggctactacctc
accgacccgcgcggcctctccagcctcgacttcttcggcaccgtgcgcggccgcctcggc
tacgccttcgaccgcaccctcgtgtacggcaccggcggcttcgcctacggctcgggcagc
gccgaccgctccttcggcggctacgccggcaacgacagcttccgcaccggctgggccgcc
ggcggcggcatcgagtacgccctgcccaccgactcgttcctgaacttcttccgctcctcg
gccgtgacgctgaaggtcgaaggcctgtacgtgaacctcgaccgcaacacccgcaaccag
ggcgcgttcgtcatcaacgccgccaacaacttcccggtcgtctacagcggcgtcggtcgc
cgcgacgaccagttcgccgtcgtccgcgccggtctgaactacaagttcggcacgttctag

DBGET integrated database retrieval system