KEGG   Methylobacterium radiotolerans: Mrad2831_5412Help
Entry
Mrad2831_5412     CDS       T00674                                 

Definition
(GenBank) protein of unknown function DUF185
Organism
mrd  Methylobacterium radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_28
Motif
Other DBs
NCBI-ProteinID: ACB27359
UniProt: B1LYH5
Position
complement(5716304..5717374)
Genome map
AA seq 356 aa AA seqDB search
MTPLGAEIAALIRQNGPIGVDRYMALCLGHPVHGYYRTRDPLGAQGDFTTAPEISQMFGE
LLGAWTAYVRGSIGAPDPLLLVELGPGRGTLMADALRALRAALPGVRVAPHLVETSPVLR
AAQARALSGTGAVWHDSVDTLPEGPTIILANEFFDCLPVRQFERRPSGWHERQIGLDSAG
GLAFGLSPEPVPGLVADGPDGALMSVPAAGLALIRALARRLVSGGGALLVVDYGHVRPGF
GDTLQALAGHRFADPLAEPGEADLTHHVDFAALAQAARAEGAAIHGPVDQGDFLAALGLG
ARAERLRARANPAQVTAIDAAVTRLTDPGRGGMGRLFKVLAVSGPSLGPLPGFPAP
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
gtgacaccgctcggagccgagatcgcggcgctgatccgccagaacgggccgatcggtgtc
gaccgctacatggccctctgcctcgggcacccggtccacggctactaccgcacccgcgat
cccctgggcgcccagggcgacttcaccaccgcgcccgagatcagccagatgttcggcgag
ctgctcggtgcctggacagcctacgtccgcggctcgatcggggcgccggatccgctcctc
ctggtggagctggggcccggccgcggcacgctgatggcggacgcgctgcgcgccttgcgg
gcggcgctccccggggtgcgcgtggcaccgcacctcgtcgagacgagcccggtgctgcgg
gccgcgcaggcccgcgccctctccgggaccggcgccgtgtggcacgacagcgtcgatacg
ctgcccgaggggcccacgatcatcctggccaacgagttcttcgactgtctgccggtgcgc
cagttcgagcgccggccgtcgggctggcacgagcggcagatcggcctcgattcggcgggc
ggtctcgccttcggcctgtcgccggagccggtcccgggcctcgtggcggacggcccggac
ggcgcgctgatgagcgtgccggcggccggcctcgcgctgatccgcgcgctggcccgacgg
ctggtttccggtggcggcgccctgctggtcgtcgattacggccatgtccgcccgggcttc
ggcgacaccctccaggcgctggcaggacatcgtttcgccgacccgctggcggagcccggc
gaggcggatctgacgcatcacgtcgatttcgccgccctcgcccaggcggcccgggccgag
ggcgcagcgatccacggtccggtcgatcagggtgacttcctggcggcgctcggcctcggc
gcccgtgccgagcggctgagggcacgggccaatccggcgcaggtcaccgcgatcgatgcg
gccgtcacccgcctgaccgatccgggccggggcggcatgggcagactgttcaaggtgctg
gcggtgagcggcccgtccctcgggccgctcccgggatttccggcgccctga

DBGET integrated database retrieval system