KEGG   Methylobacterium radiotolerans: Mrad2831_5413Help
Entry
Mrad2831_5413     CDS       T00674                                 

Definition
(GenBank) prolipoprotein diacylglyceryl transferase
  KO
K13292  phosphatidylglycerol---prolipoprotein diacylglyceryl transferase [EC:2.5.1.145]
Organism
mrd  Methylobacterium radiotolerans
Brite
KEGG Orthology (KO) [BR:mrd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Mrad2831_5413
Enzymes [BR:mrd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.145  phosphatidylglycerol---prolipoprotein diacylglyceryl transferase
     Mrad2831_5413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LGT
Motif
Other DBs
NCBI-ProteinID: ACB27360
UniProt: B1LYH6
Position
complement(5717371..5718273)
Genome map
AA seq 300 aa AA seqDB search
MPLLALPFPAIDPVAIAIGPITIKWYALAYIAGLIGGWYYARRLVMADGLWGVVKRPQVA
DIDDLVVWVALGVVLGGRIGYVLFYNLPMYISDPWEILAIRNGGMSFHGGFVGAILAFVL
FARGKGLNAYTLLDIGAVVVPIGLFFGRIANFVNGELWGRVAPDFPYAIVFPSGGPLPRH
PSQLYEAATEGLLLFIVMALSVRRFGFRKPGLLGGIFVLGYALARTFCEFFREPDRQLGF
LFGDHVGPMGGGVTMGMLLCVPMMIVGLTYIVLAATGRTRPRHPVEAPAAEAARKAAVEA
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgccgctcctcgccctgccctttccggccatcgatccggtggcgatcgcgatcgggccg
atcacgatcaaatggtacgcgctcgcctacatcgccggcctgatcggcggctggtactac
gcgcgccgcctcgtcatggccgacggtctctggggcgtggtgaagcgcccgcaggtcgcc
gacatcgacgacctcgtcgtctgggtggcgctcggcgtcgtgctcggcgggcggatcggc
tacgtgctgttctacaatctgccgatgtacatctccgatccgtgggagatcctggcgatc
cgcaacggcggcatgtcgttccacggcggcttcgtcggggcgatcctggccttcgtgctg
ttcgcccgcggcaagggcctcaacgcctacacgctcctcgatatcggcgccgtggtggtg
ccgatcggcctgttcttcggccggatcgccaatttcgtgaacggcgagctctggggccgg
gtcgcgccggacttcccctacgcgatcgtgttcccgagcggcgggccgctgccgcgccac
ccgagccagctctacgaggcggccaccgagggcctgctgctgttcatcgtgatggcgctc
agcgtccgccggttcggcttccgcaagccggggctcctcggcggcatcttcgtcctcggc
tacgcgctggcccggaccttctgcgagttcttccgcgagccggatcgccagctcggcttc
ctgttcggcgaccatgtcggtccgatgggcggcggcgtgaccatgggcatgctgctgtgc
gtgccgatgatgatcgtcggcctcacctacatcgtgctggccgcgaccggccggacacgt
ccccgccatcccgtcgaggcgccggcggccgaggcggcccgcaaggcggccgtcgaggcg
tga

DBGET integrated database retrieval system