KEGG   Methylobacterium radiotolerans: Mrad2831_5414Help
Entry
Mrad2831_5414     CDS       T00674                                 

Definition
(GenBank) Glyoxalase/bleomycin resistance protein/dioxygenase
Organism
mrd  Methylobacterium radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyoxalase Glyoxalase_4 Glyoxalase_3
Motif
Other DBs
NCBI-ProteinID: ACB27361
UniProt: B1LYH7
Position
complement(5718356..5719288)
Genome map
AA seq 310 aa AA seqDB search
MSGIAPPSGIAPKSGVRALVGFGRTVADLAVTEAFYRDGLGFARIAPPEPLPGAQAEAMG
LAGRRATQLRMRLGGQSVTFLTVDPPGAPYPADPAATDPFFQHLAVPVRDMGAAAAQLAR
LAPMPISRGGPQRLPASTGGVTAYKFRDPDGHPLELIYFPDGPAATRWRDAPGLFLGIDH
SAITVTDLDATLAFLTGSLGLWVAERGLNRGPEQARLDGVDDPQVDVIALEPPEPAPHVE
LLHYRTPATERRLVFGPADRASTRSVFTAADPQSLSHRLRESGQTPLTSADGAAAYCAGP
DGHGFLFVRG
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggcatcgcccccccgagcggcatcgctcccaagagcggcgtgcgcgccctcgtc
ggcttcggccgcaccgtcgcggacctcgccgtcaccgaagccttctaccgggacgggctc
ggcttcgcgcggatcgctccaccggaacccctgcccggcgcgcaggcggaggcgatgggc
ctcgcgggccggcgcgccacgcagctgcgcatgcggctcggcgggcagagcgtgacattc
ctgacggtggatccgcccggcgcgccctacccggccgatccagcggcgacggatccgttc
ttccagcacctagcggtcccggtccgcgacatgggggccgcggcggcgcagctggcacgg
ctcgcaccgatgccgatcagccgcggcgggccgcagcgtctgccggcctccacgggaggc
gtgaccgcctacaagttccgcgaccccgacgggcatcccctggagttgatatactttccc
gacgggcccgccgcgacccgctggcgcgacgcgccgggcctgttcctgggaatcgaccac
tcggcgatcaccgtcaccgacctcgacgccaccctggccttcctgaccgggtccctgggg
ctgtgggtggcggagcgcggcctgaaccgcggaccggagcaggcgcgcctcgacggcgtc
gacgatccgcaggtcgacgtgatcgccctcgagcctccggagcccgcgccgcacgtggag
ctcctgcattaccgcacgcccgcgaccgagcggcggctcgtcttcgggcccgccgaccgg
gcctccacccgctccgtgttcaccgcggcggacccgcagtccctctcgcaccgcctgcgc
gagagcggacaaactccgctgacctccgccgacggcgcggccgcctattgcgccggcccg
gacggacacggcttcttgttcgtgcgcggctga

DBGET integrated database retrieval system