KEGG   Methylobacterium radiotolerans: Mrad2831_5442Help
Entry
Mrad2831_5442     CDS       T00674                                 

Definition
(GenBank) inositol monophosphatase
Organism
mrd  Methylobacterium radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inositol_P
Motif
Other DBs
NCBI-ProteinID: ACB27389
UniProt: B1LZD7
Position
5748991..5749887
Genome map
AA seq 298 aa AA seqDB search
MTLSPTAPAPDVLAAMLAFAEEAAPLALAMRAGGLAMSNKGPDLGQALTEADLAVSQLMH
ARFGPDLIEEETAEDLGQAAARALLARDAWTFVGDPIDGTRPFAGGLSGWGVMVAACRAG
WPRACVMSLPAWNEDRSAPARGTPAEATEGLLLAASEGRAFWAPTRGGRMTTALRPLERA
ARRTGHVGWLSVTAQRYTLDYGRGWFPWSEGGAISDAALLATGRLDATLSNNRLWDLGPI
LPLFEALGFRLFHWPDLGDPPADFVDLFDAELSAHDDLWLVCRDRDQAADLATAIRRA
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaccctctcgcccaccgcacccgcgccggatgtcctcgcggcgatgctcgccttcgcc
gaggaggcggcccctctggccctcgccatgcgggcgggcggcctcgccatgagcaacaag
ggccccgatctcggccaggccctgacggaggccgacctcgccgtcagccagctgatgcac
gcgcggttcggccccgacctgatcgaggaggagacggccgaggatctcgggcaggcggcg
gcccgggcgctgctcgcccgcgacgcctggaccttcgtgggtgacccgatcgacgggacc
cggcctttcgcgggcggcctgtcgggctggggcgtcatggtggcggcctgccgcgcgggc
tggcctcgagcctgcgtcatgagcctgccggcctggaacgaggaccgctcggcaccggcc
cggggcactccggcggaggctacggaggggctcctgctggcggcgagcgagggccgcgcc
ttctgggcaccgacccgcggcggccgcatgacgacggcgctgcgcccgctcgagcgcgcg
gcgcgacggaccggccatgtcggctggctgtcggtcacggcgcagcgctacaccctggat
tacggccgcggctggttcccctggagcgagggcggggcgatctcggacgccgcgctcctg
gcgaccgggcgcctcgacgcgaccctcagcaacaaccgattgtgggacctgggtccgatc
ctcccgctgttcgaggcgctgggcttccgcctgttccactggccggacctcggagatccg
ccggcggacttcgtcgacctgttcgacgcggagctgtcggcccacgacgacctctggctg
gtgtgccgggaccgcgaccaggccgccgatctggcgacggccatccgccgcgcctag

DBGET integrated database retrieval system