KEGG   Methylobacterium radiotolerans: Mrad2831_5446Help
Entry
Mrad2831_5446     CDS       T00674                                 

Definition
(GenBank) putative cytochrome c4 precursor
Organism
mrd  Methylobacterium radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrome_CBB3 Cytochrom_C Paired_CXXCH_1
Motif
Other DBs
NCBI-ProteinID: ACB27393
UniProt: B1LZE1
Position
complement(5755983..5756573)
Genome map
AA seq 196 aa AA seqDB search
MRRHLRLIRGLVYALGGLLLTGATRAAPDAAMQERLAPCIGCHGAGTSATEGVPSLGGQL
PDYVVTQLFQFREKQREAPPMNEVAAGFSDDDLRGYADAVATLPPPAWAGPPADAALAAR
AQALVAKHQCNSCHGPDLAGRDAIPRIRAQREDYLAKALAAYKSNARPGYDPAMNEVAQG
LSEADIKDLAAYVSRL
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgccatctccgtttgatccgcgggctggtctatgccctcggcgggctgctgctc
acgggcgcgacgcgcgccgccccggacgcggcgatgcaggagcgcctcgctccctgcatc
ggctgccacggggccggcacgtcggcgacggagggcgtgccttcgctcggcgggcagctc
ccggactacgtggtcacgcagctcttccagttccgggagaagcagcgggaggcgccgccg
atgaacgaggtggccgccggattctccgacgacgacctgcgcggctacgccgacgcggtg
gcgacgctgccgccgcccgcctgggccgggccaccggccgacgcggctctggcggcgcgc
gcgcaggcgctcgtcgccaagcaccagtgcaattcctgccacggaccggacctcgcgggc
cgcgacgcgatcccgcggatccgcgcgcagcgggaggattacctcgccaaggcgctcgcc
gcctacaagtcgaacgcccggcccggctacgatcccgccatgaacgaggtcgcgcagggc
ctgagcgaggcggacatcaaggatctcgcggcctacgtgtcgcggctctga

DBGET integrated database retrieval system