KEGG   Methylobacterium radiotolerans: Mrad2831_6326
Entry
Mrad2831_6326     CDS       T00674                                 
Name
(GenBank) P-type DNA transfer protein VirB5
  KO
K03200  type IV secretion system protein VirB5
Organism
mrd  Methylobacterium radiotolerans
Pathway
mrd03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:mrd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Mrad2831_6326
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mrd02044]
    Mrad2831_6326
Secretion system [BR:mrd02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   Mrad2831_6326
SSDB
Motif
Pfam: T4SS UPF0184 YlbD_coat YicC_N MapZ_EC1 CENP-Q
Other DBs
NCBI-ProteinID: ACB28248
UniProt: B1M9S3
Position
pMRAD02:24926..25636
AA seq 236 aa
MKKYALILAATLALSGTAFAGVPVTVIADVPAITNQIETMAKWKAQYDQMVSQIDQMKQQ
YASITGSRGMGQIMNNPALRDYLPSDWQKVYDSVRTGGYNGLSGSAAAIYDNNKVFDACG
RLPAGTQRTACEAAAVKPAQDKAFAGDAYAAAKSRLDQINSLMGQINQTKDPKAIAELQG
RIASEQAMIANEQTKLQLFQMMAQADEKLQEQRKREINAQQLARRGHLDLQPLTFN
NT seq 711 nt   +upstreamnt  +downstreamnt
atgaagaagtacgcattgatcctggccgccacgcttgccctctcgggcacggcgttcgcc
ggcgtcccggtaacggtcatcgccgacgttccggccatcaccaatcagatcgagaccatg
gccaagtggaaggcccaatacgatcagatggtcagccaaatcgatcagatgaagcagcaa
tacgcgtccatcaccggatcgcgcggcatgggtcagatcatgaacaacccggcgctgcgc
gactacctgccgtccgactggcagaaggtctacgactccgtccgcacgggcggctacaac
ggcctcagcggctccgcagcggccatctacgacaacaacaaggtgttcgatgcctgcggg
cgtttgccggcgggcacgcagcgcacggcatgcgaggccgcagcggtgaagccggcgcag
gacaaggcgttcgctggcgatgcctatgcggcggcgaagtcgcggctggatcaaatcaac
tcgctcatgggtcagattaaccagacgaaagatccgaaggcgatcgccgaactgcaagga
cgcatcgcgtccgagcaagcaatgatcgccaacgaacagaccaaactccagttgtttcag
atgatggcgcaggccgacgagaagcttcaggagcagcgcaagcgcgagatcaacgctcag
cagctcgcgcggcgcggtcacctggatctgcaacccttgacgttcaactaa

DBGET integrated database retrieval system