KEGG   Methylobacterium radiotolerans: Mrad2831_6329
Entry
Mrad2831_6329     CDS       T00674                                 
Name
(GenBank) TraI protein
  KO
K03202  type IV secretion system protein VirB7
Organism
mrd  Methylobacterium radiotolerans
Pathway
mrd03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:mrd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Mrad2831_6329
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mrd02044]
    Mrad2831_6329
Secretion system [BR:mrd02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   Mrad2831_6329
SSDB
Motif
Pfam: LPAM_1 O_Spanin_T7 DUF1459
Other DBs
NCBI-ProteinID: ACB28251
UniProt: B1M9S6
Position
pMRAD02:27186..27356
AA seq 56 aa
MKQCITLLCLVAMLAGCASNAAVVPALEGRARVPVNKQVPAQPPLTQQPTSSAQGE
NT seq 171 nt   +upstreamnt  +downstreamnt
atgaaacagtgcattaccttgctttgccttgtcgccatgctggcgggatgtgcaagcaac
gcagccgtcgtcccggcactagagggacgcgcacgcgtgccggtgaacaagcaggttccg
gcgcagcccccgctcacacagcagccgaccagctcggcgcagggggaatga

DBGET integrated database retrieval system