KEGG   Meiothermus ruber DSM 1279: K649_01655Help
Entry
K649_01655        CDS       T02636                                 

Gene name
apaG
Definition
(GenBank) CO2+/MG2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
mre  Meiothermus ruber DSM 1279
Brite
KEGG Orthology (KO) [BR:mre00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    K649_01655 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AGK03635
UniProt: M9X633
Position
318006..318386
Genome map
AA seq 126 aa AA seqDB search
MPIRNDIHVKVEVVYAQAHSRPGQHVFVYFITLENQGHETVQLLRREWFIQDGWGGVVHV
EGEGVVGEKPILEPGQLYRYNSFCPLAHPPGLMWGFYTFQNMLGALFRVEIPAFALRLPD
AHRTLN
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
ttgcccatccggaacgacatccatgtgaaggtagaggtggtctacgcccaggcgcactcg
aggcccgggcagcacgtctttgtatacttcatcaccctggaaaaccagggccacgagacg
gtgcagctcctgcgtcgggaatggttcattcaagacggctggggtggggtggtgcacgtg
gagggtgagggggtggtgggtgagaagcccatcctcgagcccggtcagctttacagatac
aacagtttttgccccttggcccacccccctggcttaatgtggggtttctataccttccag
aacatgctgggcgcgctgttccgcgtcgagataccggcctttgccctgcgcctgccggat
gcccaccgcaccctcaactag

DBGET integrated database retrieval system