KEGG   Meiothermus ruber DSM 1279: K649_01880Help
Entry
K649_01880        CDS       T02636                                 

Definition
(GenBank) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
mre  Meiothermus ruber DSM 1279
Pathway
mre00130  Ubiquinone and other terpenoid-quinone biosynthesis
mre00627  Aminobenzoate degradation
mre01100  Metabolic pathways
mre01110  Biosynthesis of secondary metabolites
mre01120  Microbial metabolism in diverse environments
mre01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mre00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    K649_01880
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    K649_01880
Enzymes [BR:mre01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     K649_01880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: AGK03680
UniProt: D3PMQ3
Position
371153..371743
Genome map
AA seq 196 aa AA seqDB search
MSVPKRLVVGLSGASGMPYALDLLQTLRRVGGLEVHLVMSQGAKRVLAEEAGLSLEAVEA
LAHVVHRSSDLGAPIASGSFRTLGMVIVPCSATTLAKVAYGLADNLLTRAAYVTLKERRP
LVLVPREAPLPLPSLEAMVKATLAGATILPAAPGFYHKPQTIEDLLAFMTQRILDLLGLE
YSRAPRWGELQELELD
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtacccaagcgactggtggtggggctttcgggcgcttcggggatgccctacgcc
ctggatctgctgcaaaccctgcgacgggtgggggggttggaagtccacctggtgatgagc
cagggggccaagcgggtgctggcggaggaggcggggctgagcctcgaggctgtggaggcc
ctggcccatgtggtgcaccgcagcagcgacctgggggcccccattgcctcggggagcttt
cgtaccctgggtatggtgattgtgccgtgcagtgcgaccaccctggctaaggtggcctac
ggtctggccgacaacctcctgacccgggcggcctatgtgaccctcaaggagcgccgcccc
ctggtgctggtgccgcgcgaggccccgctgcctttgccgagcctcgaggccatggtcaaa
gccaccctggccggggccaccatactgccggctgcccccggcttctaccacaagccccaa
accatcgaggatctgctggcttttatgacccagcgcattttggatctgttggggcttgag
tactccagggcgccgcgctggggcgagttacaggagctcgagctcgactag

DBGET integrated database retrieval system