KEGG   Meiothermus ruber DSM 1279: K649_12305Help
Entry
K649_12305        CDS       T02636                                 

Definition
(GenBank) phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
mre  Meiothermus ruber DSM 1279
Pathway
mre00770  Pantothenate and CoA biosynthesis
mre01100  Metabolic pathways
Module
mre_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:mre00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    K649_12305
Enzymes [BR:mre01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     K649_12305
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     K649_12305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein
Motif
Other DBs
NCBI-ProteinID: AGK05749
UniProt: D3PTL9
Position
2469926..2471152
Genome map
AA seq 408 aa AA seqDB search
MNPLQGKRIVLGVSGSIAAYKAADLASKLTQAGALVDVILSEGAERFITPLTFASLTGRR
AYASLWEGEAHVLHVGLGEAADLLVIAPCTAHTLAKLAQGQADNLLTLTALAARCPVLVA
PAMDGGMFEHPATQANLETLRRRGVQILGPAQGRMASGLVGLGRMLEPAEILGQIRLALG
RGGPLAGKHVVVSAGGTQEPLDPVRYLTNRSSGKQGFALAQAALDLGARVSLVVGATAAA
LPTPTGAERTDVETAAQMAEAVLRLCREADVLIMAAAVADFRPRQVRAHKIKKEREAPQL
ELEPTPDILLAVAEERRHLGRPAVVVGFAAESEKLRENAQDKLERKSLSMIVANDISAPD
AGFAVDTNRVLLLLPGGVVEPLPLMTKGEVAAAVLARVVGLLAEGAQG
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaaccccctgcagggcaagcgcatcgtgctgggcgtgagcggctccatcgctgcctac
aaggccgccgacctcgccagcaagctcacccaggccggggccctggtggatgtgatcctg
agcgagggggccgagcgtttcatcaccccgctcaccttcgcctcccttaccgggcgcagg
gcctacgccagcctgtgggagggcgaggcccacgtgcttcacgtcggattgggggaggcc
gccgacttgctggtgatcgccccctgcaccgcccacaccctggccaagctggcccagggc
caggccgacaacctgcttaccctgaccgccctggccgcgcgctgtcccgtgctggtggcc
cccgccatggacggggggatgttcgagcaccccgccacccaggccaacctcgagaccctg
cgccgccggggtgtgcagatcctgggccctgcccagggtcgcatggcctcggggctggtg
gggctggggcggatgctcgagcccgccgagatcctggggcagattcgcctggccctgggc
cgcggcggccccctggccggaaaacacgtggtggtgagcgcgggcggcacccaggagccc
ctcgacccggtgcgctacctcaccaaccgctcctcgggcaaacagggttttgccctggcc
caggccgcgctggatctgggggctcgggtcagcctggtggtgggggctacggccgctgcc
ctgcccacccccaccggggccgagcgcaccgacgtggaaaccgccgcccagatggccgag
gcggtcttgcggctgtgccgggaggcggatgtgctgatcatggcggccgcggtggccgac
ttccggccccgccaggtgcgggcccacaagatcaagaaggagcgggaagccccccagctc
gaactcgagcccaccccggacatcctgctggccgtggctgaagagcgccggcacctgggc
cggccagcggtggtggtgggcttcgccgccgagagtgagaaactgcgggagaacgcgcag
gacaagctcgagcgcaaaagtctctccatgatcgtggccaacgatatcagcgcccccgat
gccggtttcgccgtggacaccaaccgcgttcttctgctgctgccgggcggggtggtcgag
cccctgcccctcatgaccaagggcgaggtggccgcagccgttctggcgcgggtggttggt
ctcctcgcagagggagcccagggatag

DBGET integrated database retrieval system