KEGG   Mycobacterium rhodesiae: MycrhN_0804Help
Entry
MycrhN_0804       CDS       T01685                                 

Definition
(GenBank) exodeoxyribonuclease V, alpha subunit
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mrh  Mycobacterium rhodesiae
Pathway
mrh03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mrh00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MycrhN_0804
Enzymes [BR:mrh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     MycrhN_0804
DNA repair and recombination proteins [BR:mrh03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     MycrhN_0804
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Viral_helicase1 Helicase_RecD AAA_11 AAA_22 UvrD-helicase AAA_16 PhoH AAA_28 NTPase_1 Mg_chelatase AAA_29 DUF3322 T2SSE AAA_25 UvrD_C AAA_5 Herpes_Helicase ATPase SRP54 NACHT CbiA DUF2075 AAA AAA_24 TrwB_AAD_bind MukB
Motif
Other DBs
NCBI-ProteinID: AEV71435
UniProt: G8RQM9
Position
825112..826797
Genome map
AA seq 561 aa AA seqDB search
MSLEAFEELFEPADTHVARRLTAIANEPDESVALAIAVAVRALRGGSVCVDLRSIADQLE
MPDLPWPSPDDWLNAVRASPLATDKPVLRLYSDSTADLLYLDRYWLEEQQVCDDVLTLLS
STLPGAVPGLERLFPEGWEEQRAAAEIALTQSLTVLTGGPGTGKTTTVARLLALLAEQAS
LSGKPPLRIALAAPTGKAAARLLEAVQLEIDKLDAVDRDRLPELKASTLHRLLRTRPDNS
SRFRHHRENRLPHDVIVVDETSMVSLTLMARLLEALRPDSRLLLVGDPDQLASVEAGAVL
ADMVDGLGERSDVRIAALTTSHRFGKSIGALASAIRVGDADEVVSLLRAGGEHIEWLETD
EPAEHLRKVLLPHALRLREAAILGDVTAALSTLDEHRLLCAHRRGPYGVRFWNHHVERWL
ADATGEPLWTQWYAGRPVLVTANDYGLGLYNGDTGVTVVRGDGLRAVVAAGSEPIEFATG
RLPDVDTMHAMTIHKSQGSQADEVTVLLPPEDSRLLTRELFYTAVTRAKERIRVIGTEPS
VRAAVQRRAVRASGLAQRLRA
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
gtgagtctcgaggcgttcgaggagctcttcgagccggccgacacccacgtcgcgcgacgg
ctcacggcgatcgccaacgagcccgacgaatcggtcgcgttggccatcgccgtcgcggtg
cgggcgctgcgcggcgggtccgtgtgcgtggatctgcggtcgatcgccgaccaactcgag
atgcccgacctgccctggccgtcgccggacgactggctgaacgcggtgcgggcgagcccc
ctcgccaccgacaagccggtgctgcgactctactcggattccaccgccgacctgctctac
ctggaccggtactggctggaagaacagcaggtgtgcgacgacgtgctgacgctgttgtcg
tcgaccctgcccggcgcggtgcccggtctcgagcggctcttccccgaaggctgggaggaa
cagcgcgcggcggcggaaatcgctctcacacagtcgcttacggtgctgaccggcgggccg
ggcacaggtaagaccacgacggtcgcgcggctgctggcgctgctggccgagcaggcgtcg
ctgtctggcaagccgccgctgcgcatcgcgctcgcggcgccgaccggtaaggcggccgcg
cggctactcgaagcggtgcagctggagatcgacaagctcgacgccgtcgatcgcgaccgg
ctgccggaattgaaggcctcgacgctgcatcggctgctgcggacacggccggacaactcg
tcgcggttccggcatcaccgcgagaaccggctgccgcacgacgtgatcgtcgtcgacgag
acgtcgatggtgtcgctgacactgatggcgcgactgctcgaagcgttgcgccccgacagc
cggctgctactggtcggcgaccccgaccagctggcctcggtcgaggcgggtgcggtgctc
gcggacatggtcgacggcctcggcgagcggtctgacgtgcgcatcgcggcgttgacgacg
tcgcaccggttcggcaagtcgatcggcgcgctggcctcggccatccgggttggtgacgcc
gatgaggtcgtctccctgctgcgggccggcggcgagcacatcgaatggctcgagaccgac
gagcccgccgagcatctgcgcaaagtgcttctcccccatgccttgcggctgcgggaagcg
gcgatcctcggcgatgtgacggccgcgctgtcgacgctggacgagcaccgactgttgtgc
gcgcaccggcgcgggccgtacggggtgcggttctggaatcaccacgtcgagcgatggctg
gccgatgcgaccggtgagccgctgtggacgcagtggtacgccggtcggcccgtgctggtg
accgccaacgactacgggttgggtctgtacaacggagacaccggcgtgacggtcgtgcgc
ggcgacgggctgcgcgccgtcgtggccgccgggtccgaaccgatcgagttcgcgaccggg
cggctccccgacgtcgacacgatgcacgccatgacgatccacaagtcgcagggcagtcag
gccgacgaggtgaccgtgttgctgccgcccgaggattcgcgcctgctgacccgcgagctg
ttctataccgcggtgacgcgcgccaaggagaggatccgcgtcatcgggaccgaaccgtcg
gtacgcgcggcggtgcagcggcgagcggtccgagcgtccgggctggcgcagcgcctgcgg
gcctag

DBGET integrated database retrieval system