KEGG   Mycolicibacterium rhodesiae: MycrhN_1051Help
Entry
MycrhN_1051       CDS       T01685                                 

Definition
(GenBank) phosphate/sulfate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
mrh  Mycolicibacterium rhodesiae
Brite
KEGG Orthology (KO) [BR:mrh00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    MycrhN_1051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 DUF4131 OPA3
Motif
Other DBs
NCBI-ProteinID: AEV71677
UniProt: G8RU24
Position
complement(1078690..1079967)
Genome map
AA seq 425 aa AA seqDB search
MTAHGRRISAVSAELIILVLLITTALAFDFTNGFHDTGNAMATSIATGALKPKTAVLLAG
ILNLVGAFLSVEVAVTVTTSVLKVQDTKTGALIPNIDASTGLTIIFAGLIGGILWNLLTW
LFGIPSSSSHALFGGLIGAGLAALGMAGVNWSGVTGKVLIPAVAAPVIACLVAGCGTWLV
YRLTRNVVESRRREGFRWGQIATASLVALSHGTNDAQKTMGVIALALITTGHLSGDVKEQ
GLPFWIIFSCAVAIGLGTYLGGWRVIRTLGKGLVEIESPQGFAAEASSAAIILSSSAAGM
ALSTTHVATGSILGSGVGKPGAQVRWSVAGRMAIAWLITLPAAGIMGALAYWLSYGVESL
TGSALAGDGLIFLVLVALSFYMWWRAQQQKVDSSNVNADWDSSTNSVVPADVREAADEPK
PTASV
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgcatggccgcagaattagcgccgtgagcgcagagctgatcatcctggtgctg
ctgattacaacggcactggcgttcgacttcaccaacgggttccacgacaccggaaacgcg
atggcgacgtcgatcgccacgggtgcgttgaagcccaagaccgccgtgctgctcgccggc
atcctgaaccttgtcggcgccttcctctcggtcgaggtcgcggtcaccgtcaccacctcg
gtgctgaaggtgcaggacaccaagaccggagcgctgatcccgaacatcgacgcctcaacg
ggtctgaccatcatcttcgccggcctcatcggcggcatcctctggaacctgctgacctgg
ctgttcggtatcccctccagctcgtcgcacgcgctcttcggcgggctcatcggtgccggc
ctcgcggcgctcggtatggcgggtgtcaactggtccggcgtcaccggcaaggtcctgatc
ccggccgtggccgcgccggtcatcgcgtgcttggtcgcggggtgcggtacgtggctggtg
taccggctcacccgcaacgtcgtcgagagccggcggcgggagggcttccgctggggccag
atcgcgaccgcctcgctggtcgccttgtcgcacggcaccaacgacgcgcagaagaccatg
ggcgtcatcgcgctcgccctcatcacgaccggccacctgtcgggcgatgtcaaggaacag
ggtctgccgttctggatcatcttcagctgcgcggtcgccatcggcctcggcacctacctc
ggcggctggcgcgtcatccgcacgctgggcaaggggctcgtcgagatcgagtcgccgcag
ggcttcgccgccgaagcatcctcggccgcaatcatcttgagctcgagcgctgccggtatg
gcgctgtcaacgactcacgtcgcgacgggatcgatcctgggcagcggtgtcggcaagccc
ggcgcccaggtccggtggtcggtcgcaggccggatggccattgcgtggctgatcacgctg
cccgccgccggaatcatgggtgcgctggcgtactggctctcgtatggcgtcgagtcgctc
accggttctgcactggccggtgacggtctgatcttcctcgtcctggtggcgctgtccttc
tacatgtggtggcgcgcccagcagcagaaggtggacagcagcaacgtcaacgcggactgg
gacagctccacgaactccgtcgtgcctgcggacgtacgtgaggccgccgacgaacccaag
cccacggcgtcggtctag

DBGET integrated database retrieval system