KEGG   Mycolicibacterium rhodesiae: MycrhN_1510Help
Entry
MycrhN_1510       CDS       T01685                                 

Definition
(GenBank) arylamine N-acetyltransferase
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
mrh  Mycolicibacterium rhodesiae
Pathway
mrh00633  Nitrotoluene degradation
mrh01100  Metabolic pathways
mrh01110  Biosynthesis of secondary metabolites
mrh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mrh00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    MycrhN_1510
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    MycrhN_1510
Enzymes [BR:mrh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     MycrhN_1510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-ProteinID: AEV72126
UniProt: G8RHX6
Position
complement(1545961..1546785)
Genome map
AA seq 274 aa AA seqDB search
MTDLAAYLDRIDYAGPTDATIDTLHALVAAHNSAIPFENLDPLMGIPVVDLSRAALFDKL
VQRRRGGYCYEQNGVMGYVLAELGFGVQRLGGRVVWMNHSEELPAQTHEALSVTVPGVQG
PWLVDVGFGGQTLSSPIRLEVDAVQPTRHEPYRIREHGDGLLLEAQIRSEWHALYTFTTK
PQPQIDREVGSWYVSTYPKSVFVVGLSAALLTDDARWNLRGRNLAIHSAGDTERIRFATA
ADVLNALTDRFGIDLTDLGDRVDVEARVNAVLDC
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacctagccgcttacctggaccgcatcgactacgccggcccgacggacgccacg
atcgacacgctgcacgcgcttgttgcggcgcacaacagtgcgatcccgttcgagaacctc
gaccccctgatgggtatcccagtcgtcgacctgagcagggccgcactgttcgacaaactc
gtgcagcggcgtcgcggtggttactgctacgagcagaacggcgtgatgggatatgtgctg
gcggagttaggctttggcgtgcaacgcctcggcgggcgcgtggtctggatgaaccactct
gaggagctacccgcgcagacgcatgaggcattgtcggtgacggtgcccggcgtccaggga
ccgtggctcgtcgacgtcgggttcgggggccagacgctgtcgtcgccgattcggctcgag
gtcgacgcggtacaacccacgcggcacgagccctaccgcattcgcgagcacggtgacggg
ttgcttctcgaggcgcagatccgcagcgagtggcacgcgctctacacgttcacgacgaag
ccacaaccgcagatcgaccgcgaagtcggtagttggtacgtgtcgacgtatcccaagtcc
gtcttcgttgtcggtctgtcggcggcgctgctcaccgacgacgcccggtggaatcttcgc
ggccgcaacctggcaatccacagtgctggggacaccgagcggattcggttcgcgacggca
gcagatgtgctgaacgcgttgacggaccggttcggcatcgacctgaccgacctcggtgac
cgggtggatgtcgaggcgcgggtcaacgcggttctggactgctga

DBGET integrated database retrieval system