KEGG   Mycolicibacterium rhodesiae: MycrhN_1614Help
Entry
MycrhN_1614       CDS       T01685                                 

Definition
(GenBank) 2-haloalkanoic acid dehalogenase, type II
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
mrh  Mycolicibacterium rhodesiae
Pathway
mrh00361  Chlorocyclohexane and chlorobenzene degradation
mrh00625  Chloroalkane and chloroalkene degradation
mrh01100  Metabolic pathways
mrh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mrh00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MycrhN_1614
   00361 Chlorocyclohexane and chlorobenzene degradation
    MycrhN_1614
Enzymes [BR:mrh01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     MycrhN_1614
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like RNA_pol_Rpb2_5
Motif
Other DBs
NCBI-ProteinID: AEV72229
UniProt: G8RJ41
Position
complement(1649907..1650608)
Genome map
AA seq 233 aa AA seqDB search
MVKALAFDTFGTVVDWRSSIIAELGVFGETHGVQHDWATLADGWRKGYLPAMDRVRRGEL
PWTKIDDLHRMILEELLGAAGITSVSDADVDHLNRAWHRLNPWPDSVAGLTRLKERFVIT
TLSNGNMSLLTNMAKRAGLPWDCVISAELFHHYKPDPEAYLGCAELLDVSPEELMLVAAH
PGDLRAAQQAGLRAAYVTRPLEYGPNQRAHKVAEGEFDFTATDFLDLADQLGA
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaggcgctggcgttcgacacgttcggcaccgtcgtcgactggcgttcgagcatc
atcgccgagctcggggtgttcggtgaaacccatggtgttcaacatgattgggcaaccctc
gccgacggttggcgtaagggatatctgcccgcgatggatcgtgttcgccgcggggagctg
ccgtggaccaagatcgacgacctgcaccggatgatcctcgaggaacttctgggcgcggcg
ggcatcacgtcggtcagcgatgcggacgtcgaccatctcaaccgcgcgtggcaccgtctg
aacccctggcccgacagcgtcgcgggcctcacgcggctgaaggaacgcttcgtcatcacg
acgctgtcgaacggcaacatgtcgctgctgaccaacatggccaagcgcgcggggctgccg
tgggactgcgtgatctccgccgagttgttccatcactacaaacctgatcccgaggcctat
ctcggctgtgccgagctgctcgacgtgtcaccggaggagctcatgctggtcgccgcgcat
cccggggacctgcgggcggcacagcaagcggggctgcgggccgcgtacgtcacacgcccc
ctggagtacggacccaatcagcgggcgcacaaggtcgccgagggcgaattcgacttcacg
gcaaccgattttctggatctggccgaccaactcggcgcctga

DBGET integrated database retrieval system