KEGG   Mycobacterium rhodesiae: MycrhN_2285Help
Entry
MycrhN_2285       CDS       T01685                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mrh  Mycobacterium rhodesiae
Pathway
mrh00071  Fatty acid degradation
mrh00072  Synthesis and degradation of ketone bodies
mrh00280  Valine, leucine and isoleucine degradation
mrh00310  Lysine degradation
mrh00362  Benzoate degradation
mrh00380  Tryptophan metabolism
mrh00620  Pyruvate metabolism
mrh00630  Glyoxylate and dicarboxylate metabolism
mrh00640  Propanoate metabolism
mrh00650  Butanoate metabolism
mrh00900  Terpenoid backbone biosynthesis
mrh01100  Metabolic pathways
mrh01110  Biosynthesis of secondary metabolites
mrh01120  Microbial metabolism in diverse environments
mrh01130  Biosynthesis of antibiotics
mrh01200  Carbon metabolism
mrh01212  Fatty acid metabolism
mrh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mrh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MycrhN_2285
   00630 Glyoxylate and dicarboxylate metabolism
    MycrhN_2285
   00640 Propanoate metabolism
    MycrhN_2285
   00650 Butanoate metabolism
    MycrhN_2285
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MycrhN_2285
   00072 Synthesis and degradation of ketone bodies
    MycrhN_2285
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MycrhN_2285
   00310 Lysine degradation
    MycrhN_2285
   00380 Tryptophan metabolism
    MycrhN_2285
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MycrhN_2285
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MycrhN_2285
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MycrhN_2285
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mrh04147]
    MycrhN_2285
Enzymes [BR:mrh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MycrhN_2285
Exosome [BR:mrh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MycrhN_2285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C DUF3857
Motif
Other DBs
NCBI-ProteinID: AEV72875
UniProt: G8RT63
Position
complement(2313185..2314360)
Genome map
AA seq 391 aa AA seqDB search
MGNPVIVEATRSPIGKRNGWLSGLHATELLGATQKALVEKARHDSGFEIDMVEQVIGGCV
TQFGEQSNNITRVSWLVAGLPEHVGATTIDCQCGSAQQANGLVMGLIAAGAIDIGIACGI
EAMSRVGLGANAGPDRGILRPASWDIDLPDQFTAAERIAQRRGITREEIDQFGFDSQRKA
AQAWAEGRFDREISGIEAPVLDENKQPTSDRHIVSKDQGLRDTTLEGLNSLKPVIEGGIH
TAGTSSQISDGAAAVLWMDEDKARALGLKPRARIVSHALVGSEPYYHLDGPVQSTAKVLE
KAGMKMGDIDITEINEAFASVVLSWARVHNPDMDKVNVNGGAIALGHPVGSTGARLITTA
LHELERTDKSTALITMCAGGALSTGTIIERI
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaccctgtcatcgttgaagccacccgcagccccatcggtaagcggaatggatgg
ctatctggcctacacgccaccgagttgctgggcgcaacacagaaggctctcgtcgaaaag
gccaggcacgactctggctttgaaatagacatggtcgagcaggtgatcggcgggtgcgtc
acgcagttcggcgagcagtccaacaacatcacccgggtgagctggctggtcgccggactg
cccgaacacgtcggcgccaccaccatcgactgccagtgcggtagcgcgcagcaggccaac
ggcctcgtcatgggcctcatcgcggcaggcgccatcgacatcggcatcgcctgcggcatc
gaggcgatgagccgcgtcgggctcggcgccaacgccggacccgaccgcgggatcctgcga
cccgcgtcgtgggacatcgacctgcccgaccagttcaccgccgccgagcgcatcgcgcag
cgccgcgggatcacccgcgaggagatcgaccagttcggcttcgactcgcagcgcaaggcc
gcccaggcctgggccgaaggacgcttcgaccgcgagatcagcggtatcgaggcgccggtg
ctcgacgagaacaagcagccgaccagcgaccgccacattgtgagcaaggaccagggcctg
cgcgacaccacgctcgaaggtctgaactcgctcaagccggtgatcgagggcggaattcac
accgcgggtacctcgtcgcagatctccgacggcgccgccgccgtgctgtggatggacgag
gacaaggccagggcgctcggcctgaagccgagggcgcggatcgtcagccacgcactggtc
ggctccgagccgtactaccacctcgacggcccggtgcagtcgacggcgaaggtgctcgag
aaggccgggatgaagatgggcgacatcgacatcaccgagatcaacgaggcctttgcgtcg
gtcgtgctgtcgtgggcgcgcgtacacaacccggacatggacaaggtgaacgtcaacggc
ggcgcgattgcgctcggtcacccggtcggatcgacgggcgcccggctcatcacgaccgcg
ctgcacgagttggagcgcaccgacaagagcaccgcgctgatcaccatgtgcgcaggcggc
gcgctgtccaccggaacgatcatcgagcggatctga

DBGET integrated database retrieval system