KEGG   Mycobacterium rhodesiae: MycrhN_2617Help
Entry
MycrhN_2617       CDS       T01685                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
mrh  Mycobacterium rhodesiae
Pathway
mrh00071  Fatty acid degradation
mrh00280  Valine, leucine and isoleucine degradation
mrh00281  Geraniol degradation
mrh00310  Lysine degradation
mrh00362  Benzoate degradation
mrh00380  Tryptophan metabolism
mrh00410  beta-Alanine metabolism
mrh00640  Propanoate metabolism
mrh00650  Butanoate metabolism
mrh00903  Limonene and pinene degradation
mrh00930  Caprolactam degradation
mrh01040  Biosynthesis of unsaturated fatty acids
mrh01100  Metabolic pathways
mrh01110  Biosynthesis of secondary metabolites
mrh01120  Microbial metabolism in diverse environments
mrh01130  Biosynthesis of antibiotics
mrh01200  Carbon metabolism
mrh01212  Fatty acid metabolism
Module
mrh_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mrh00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MycrhN_2617
   00650 Butanoate metabolism
    MycrhN_2617
  Lipid metabolism
   00071 Fatty acid degradation
    MycrhN_2617
   01040 Biosynthesis of unsaturated fatty acids
    MycrhN_2617
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MycrhN_2617
   00310 Lysine degradation
    MycrhN_2617
   00380 Tryptophan metabolism
    MycrhN_2617
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MycrhN_2617
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MycrhN_2617
   00281 Geraniol degradation
    MycrhN_2617
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MycrhN_2617
   00930 Caprolactam degradation
    MycrhN_2617
Enzymes [BR:mrh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     MycrhN_2617
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MycrhN_2617
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     MycrhN_2617
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 F420_oxidored DUF3368 NAD_binding_8 UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: AEV73198
UniProt: G8RXF0
Position
2629697..2631859
Genome map
AA seq 720 aa AA seqDB search
MSTVNTIKWDKDADGIVTLTLDDPTGSANVMNEHYSESMHNAVERLVAEKDSITGVVITS
AKKTFFAGGDLKGMIKLGPDDAGEAFSTVENVKRDLRALETLGKPVVSAINGAALGGGLE
ITLATHHRIIADVPGAVVGFPEVTLGLLPGGGGVARSVRMFGIQKAFMELLSQGTRFKPG
KAKEIGLVDEVLPTVEELVPRAKAWIKEELKDNPDRVFQQPWDAKGYKMPGGTPSSPGLA
GILPSFPALLKKQLKGAPMPAPRAILDAAVEGAQVDFDTASRIESRYFTSLVIGQTAKNM
IQAFFLDLQHINGGGSRPDGIAKQEIKKIGVLGAGMMGAGIAYVSAKAGFDVVLKDVSIE
AAQKGKGYSEKLEAKALERGKTTQEKSDKLLARITPTADAADLKGVDFVIEAVFESVELK
HKVFQEIEDIVEPNALLGSNTSTLPITGLAAGVKRQEDFIGIHFFSPVDKMPLVEIIKGE
KTSDEALARVFDYTLAIGKTPIVVNDSRGFFTSRVIGTFVNEALAMLGEGVAPASIEQAG
SQAGYPAPPLQLSDELNLELMHKIAAATRKAVEDVDEVYTPHPAEAVVEKMIELDRPSRL
KGAGFYEYVDGKRTGLWPGLAETFNSGSTEIPLQDMIDRMLFAEALETQKCLDEGVLTST
ADANIGSIMGIGFPPYTGGSAQFIVGYEGPGGVGKEAFVARAKELAARYGDRFNPPSSLL
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgagcactgtgaacacgatcaagtgggacaaggatgccgacggcatcgtcaccctgacg
ctggatgacccgaccggttcggccaacgtgatgaacgagcactactcggagtcgatgcac
aacgccgtagagcggcttgtcgctgagaaggattcgatcaccggcgtcgtcatcaccagc
gcgaagaagaccttcttcgccggcggtgacctcaagggcatgatcaagctcggcccggac
gacgcgggcgaagccttcagcaccgtggagaacgtcaagcgcgatctgcgcgcactggag
accctcggcaagccggtggtctcggcgatcaacggggcggcactgggcggcgggctggag
atcaccctagccacgcaccaccgcatcatcgccgacgtccccggcgcggtcgtcggcttc
cccgaggtcacgctgggcctgctgccaggcggcggcggcgtcgcccgcagcgtgcggatg
ttcggtattcagaaggccttcatggagctgctgagccagggcacgcgcttcaagcccggc
aaggccaaggagatcggtctggtcgacgaggtgctgccgaccgtcgaagaattggtgccg
agggccaaggcctggataaaagaggagctcaaggacaacccggaccgtgtctttcaacag
ccgtgggatgccaagggctacaagatgcccggcggtactccgagcagcccgggcctggcc
ggcatcctcccgtcattccccgcgctgctgaagaagcagctcaagggtgcgccgatgccg
gcgccgcgcgcgatcctcgacgcggccgtcgagggtgcgcaggtggatttcgacaccgcg
tcgcgcatcgagagccgctacttcacctcgttggtgatcgggcagaccgcgaagaacatg
atccaggcgttcttcctcgacctgcagcacatcaacggcggcggttcgcggcccgacggc
atcgccaagcaggagatcaagaagatcggcgtgctcggcgcgggcatgatgggcgcgggc
atcgcctacgtctcggccaaagccgggttcgacgtcgtgctcaaggacgtctcgatcgag
gccgcgcagaagggcaagggctactccgagaagctggaagccaaggcgctcgagcggggc
aagaccacgcaagagaagtccgacaagctgctggcgcgcatcacgccgaccgccgacgcc
gccgacctcaagggcgtcgacttcgtcatcgaggccgtgttcgagtcggttgagctgaag
cacaaggtgtttcaggagatcgaggacatcgtcgagccgaacgcgctgctcggctcgaac
acctccacgctgccgatcaccggtctggcggccggcgtgaagcgccaggaggacttcatc
ggcatccacttcttctcacctgttgacaagatgccactggtcgagatcatcaagggcgag
aagacctctgacgaggcgctggcccgcgtgttcgactacacgctggccatcggcaagacg
ccgatcgtggtcaacgacagtcgcggcttcttcaccagccgcgtcatcggcacgttcgtc
aacgaggcgctggccatgctgggcgagggtgtcgcacccgcgagcatcgagcaggcgggt
tcacaggccggctacccggcaccgccgctgcagctgtccgacgagctcaacctcgagctg
atgcacaagatcgccgcggcaacccgcaaggcggtggaagatgtggacgaggtctacacg
ccgcatccggccgaggcggtcgtcgagaagatgatcgaactcgaccgtccgtcgcggctc
aaaggcgcgggcttctacgagtacgtggacggcaagcgcaccggtctgtggccgggactg
gccgagaccttcaactcgggcagcaccgagatcccgctgcaggacatgatcgaccgcatg
ctgttcgccgaggcgctggaaacgcagaagtgcctcgacgaaggagttctcacgtcgacg
gccgacgcgaacatcggctcgatcatgggcatcgggttcccgccctacaccggcggctcg
gcccagttcatcgtcggctacgagggtcccggcggcgtcggcaaggaagccttcgtggcc
cgcgccaaggaactcgcggcccgctacggcgaccggttcaacccgccgtcgtcactcctc
tag

DBGET integrated database retrieval system