KEGG   Mycolicibacterium rhodesiae: MycrhN_3161Help
Entry
MycrhN_3161       CDS       T01685                                 

Definition
(GenBank) theronine dehydrogenase-like Zn-dependent dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
mrh  Mycolicibacterium rhodesiae
Pathway
mrh00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:mrh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    MycrhN_3161
Enzymes [BR:mrh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     MycrhN_3161
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     MycrhN_3161
    1.1.1.-  
     MycrhN_3161
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C 2-Hacid_dh_C ADH_N_assoc
Motif
Other DBs
NCBI-ProteinID: AEV73694
UniProt: G8RMM7
Position
3169827..3170852
Genome map
AA seq 341 aa AA seqDB search
MEAIVLNGNNDVGLTSVPDPAPQAGEVIIEVAATGLCGTDLHEFVAGPTFSRPPVVLGHE
ISGRIVEVGAGIDQSRIGEGAVVIPMDFCGSCHYCHRALYHLCQRPGWIGFTRNGGLANY
VAVPSRLAVRVPDVVDLEVAALTEPTAVAFHAVRRAKLLLGETVMVLGAGALGLTVIQCA
RAAGAARIYVTEPSGVRGSLARDLGATLVLDPNDPGTTARILEETRGVGVDAVFHVAGSV
EAFTQGLDCLRKQGRFMEMSSWAGAASLDVNRHLLKEIELRMVFGYDMFDDFPAVLALIA
DGKLALTPQITARIPLDRAVKEGLGGLLEGREGLVKVLVKP
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggaagcgatcgttcttaacggcaacaacgacgtcggtctgacatcggtgccagacccg
gcgccgcaggccggtgaggtcatcatcgaggtggcggcgaccggactatgtggaactgac
ctccacgagtttgtcgcgggacctaccttctcgcggccgccagtggtgctcggccacgaa
atctcgggccggatcgttgaggttggagcgggcatcgaccaatcccgcattggcgagggc
gccgtggtgattccgatggacttctgcgggagctgccactattgccaccgggcgctctat
cacttgtgccagcgcccagggtggatcggcttcacccgaaacgggggcttggcgaactac
gtcgcagtgccatctcggctcgcggtccgagtgccggacgtggtggacctcgaggtggcg
gcgctgaccgagccgacggcggtggcgttccacgcggtgcggcgagcgaaactgctcctc
ggcgaaacggtgatggtcctcggcgccggggcactcgggctcaccgtgatccagtgcgca
cgcgcagccggagctgcgcgaatctacgtcacagagccaagcggcgtacgcggcagcctg
gcgcgcgacctcggtgcgacgttggtgctcgatccgaatgaccccgggaccaccgcgcga
attttggaggagacacggggcgtaggggtggacgccgtcttccatgtggcaggcagcgtg
gaggcgttcacacaaggcctggactgccttcgcaaacaaggccgcttcatggagatgtcg
tcatgggccggtgcggcctcgctggatgtcaaccgccatctgctcaaggagatagagctc
cggatggttttcggttacgacatgttcgacgatttcccggctgttctcgccctgatcgct
gacggaaaactcgcgctaacgccgcagatcaccgctcgaatcccgctggaccgcgctgtc
aaggagggattgggcgggctattagagggccgggagggtttggtcaaggtgctggtgaag
ccgtga

DBGET integrated database retrieval system