KEGG   Mycolicibacterium rhodesiae: MycrhN_3662Help
Entry
MycrhN_3662       CDS       T01685                                 

Definition
(GenBank) delta-1-pyrroline-5-carboxylate dehydrogenase, group 1
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
mrh  Mycolicibacterium rhodesiae
Pathway
mrh00250  Alanine, aspartate and glutamate metabolism
mrh00330  Arginine and proline metabolism
mrh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mrh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MycrhN_3662
   00330 Arginine and proline metabolism
    MycrhN_3662
Enzymes [BR:mrh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     MycrhN_3662
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AEV74180
UniProt: G8RUG3
Position
3655407..3657035
Genome map
AA seq 542 aa AA seqDB search
MDAITDVPAPANEPVQDYAPASPERTRLTDALNALAADPLELPHVIGGAHRMGGGTRLDV
VQPHRHSARLGTFTNAEHADATAAIDAAIAAKPGWEATPFDERAAIFLRAADLLAGPWRE
TLCAATMLGQSKSAYQAEIDAACELIDFWRFNVGFAREIQSDQPISVRGVWNRTDYRPLE
GFVYAITPFNFTAIAGNLPSAPALMGNTVVWKPSPTQTFAAYLTMQLLEAAGLPPGVINL
LAGDGIAVSDVALADPRLAGIHFTGSTATFQHLWREVGTNIDRYHTYPRLVGETGGKDFV
LAHTSARPDVLRTALIRGAFDYQGQKCSAASRAFIARSVWQQMGDDLLSATEALPYGDVT
DLTNYGGALIDERAFSKNVTAIERAKSAPGVTVAVGGEYDDSEGYFVRPTILLSDDPADE
SFRDEYFGPILSVHVYPDDDYERIIDVVDSGARYALTGAVIADDRSAVLTAEQRLRHAAG
NFYINDKPTGAVVGQQPFGGSRASGTNDKAGSALNLLRWTSARSIKETFVAPTNHNYAHM
EA
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggacgccatcaccgacgtgcccgctccggccaatgagccagttcaggactacgccccc
gcttcacccgagcgcacccgtctcaccgatgccctgaacgcactcgccgccgacccgctc
gagctgccccacgtcatcggcggcgcccaccggatgggcggcggaacccgcctcgacgtg
gtccagccgcaccgtcactcggcacggctgggcaccttcaccaacgccgaacacgcggac
gcgaccgccgccatcgatgccgcgatcgccgccaagcccgggtgggaagccactccgttc
gacgagcgtgccgcgatcttcctgcgcgccgcggatctgttggccggcccgtggcgggaa
acgttgtgcgctgcgacaatgctcggccagtccaagtcggcctatcaggccgagatcgac
gcggcatgtgagctgatcgacttctggcggttcaacgttgggttcgcgcgcgagatccag
tccgaccagccgatcagtgtgcgtggcgtctggaaccggaccgactaccggccgctcgaa
ggtttcgtctacgccatcacaccgttcaacttcaccgcgatcgcgggcaatctgcccagc
gcccccgcgctgatgggcaacaccgtggtgtggaaaccgtcgcccacgcagacgttcgcg
gcctacctgaccatgcagttgctcgaggcggccggcttgccaccgggcgtcatcaatctg
ctggcgggcgacggcatcgcggtttccgatgtggcacttgcagatccgcgacttgccgga
atccacttcaccggatcgacggcgacgttccagcacctctggcgagaggtcggcaccaac
atcgaccgctaccacacgtatccgcgactggtcggtgagaccggcggcaaggatttcgtc
ctggcccacacctcggcccgacccgatgtgttgcgcaccgcgctcatccgcggcgcgttc
gactatcaggggcagaagtgctcggcggcatcgcgggcgttcattgcccggtcggtgtgg
caacagatgggcgacgatctgctgtcggcgaccgaagcgttgccctacggcgacgtcact
gacctgaccaactacggcggcgctctgatcgatgagcgcgcgttttcgaagaacgtcacg
gcgatcgaacgtgccaagagcgcaccgggcgtcaccgtggcagtgggcggcgaatacgac
gacagcgaagggtatttcgtccggccgacgatcctgctgtcggacgatccggctgacgag
tcgttccgcgacgaatatttcggaccgatcctgtcggtgcacgtgtaccccgacgacgac
tacgagcgcatcatcgacgtcgtcgacagcggtgcccggtacgcgctgaccggtgcggtg
atcgcggacgaccgctccgccgtcctgaccgccgaacagcgattgcgtcatgcggcgggc
aacttctacatcaacgacaagcccaccggcgcggtggtgggccagcagccgttcggcggc
tctcgagcatcgggcaccaacgacaaggcgggctcagcgctcaatctgctgcgctggact
tcggccaggtcgatcaaggagaccttcgtcgcaccgaccaaccacaactacgcacacatg
gaggcgtga

DBGET integrated database retrieval system