KEGG   Mycobacterium rhodesiae: MycrhN_4693Help
Entry
MycrhN_4693       CDS       T01685                                 

Definition
(GenBank) putative O-methyltransferase
  KO
K00545  catechol O-methyltransferase [EC:2.1.1.6]
Organism
mrh  Mycobacterium rhodesiae
Pathway
mrh00350  Tyrosine metabolism
mrh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mrh00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    MycrhN_4693
Enzymes [BR:mrh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     MycrhN_4693
Exosome [BR:mrh04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   MycrhN_4693
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_3 Methyltransf_24 DUF531 Methyltransf_25 tRNA_U5-meth_tr
Motif
Other DBs
NCBI-ProteinID: AEV75176
UniProt: G8RR64
Position
complement(4713777..4714529)
Genome map
AA seq 250 aa AA seqDB search
MSLKRRIPFLRWSFWRLAIGSRNITKTGQIGDGREAAAADYVVANARRGDIDDVIAKIDD
FAYDKSFLINIGDEKGELLDAAVRRAHTELALELGTYCGYGSLRIARAAPTATVFSVELS
EANARVAQRIWAHAGVADRVTCVVGTIGDGGKTLDALANEHGFSAGKLDLLFIDHDKAAY
LPDLQSILERGWLHPGGIVVADNMLIPGSPKYREYMREQQGKLFDTAEHKTHGEYQTLAP
DLVLESEYLG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
gtgagcctgaagcgccgcatcccgttcctgcgctggtcgttctggcggctggccatcgga
tcccgcaacatcaccaagaccggccagatcggtgacggacgcgaagccgccgccgcggac
tacgtggtggccaatgcccgccggggcgacatcgacgacgtgatcgccaagatcgacgat
ttcgcctacgacaagtcgtttctgatcaacatcggggacgagaaaggcgaactgctcgac
gccgctgtgcgccgcgcccacaccgaactggcactggagttggggacctactgtggctac
ggctcgctgcggatcgcccgtgcagcacccaccgccacggtgttctccgtcgagctgtct
gaggcgaatgctcgagtcgcacagcgcatctgggcgcacgccggagtagccgaccgggtg
acgtgtgtcgtcggcacgatcggtgacggcgggaagacactcgacgcgctggccaacgag
cacggcttctccgccggaaagctcgacctgctgttcatcgaccacgacaaagccgcctac
ctgcccgacctgcaatccatcctggagcgcggctggctgcatcccggagggatcgtcgtc
gccgacaacatgctcattcccggctcccccaagtaccgcgaatacatgcgcgagcagcag
ggcaagctcttcgacaccgccgagcacaaaacgcacggcgagtatcagacgctggcaccc
gacctcgtgctcgagtcggaatacctgggctag

DBGET integrated database retrieval system