KEGG   Mycobacterium rhodesiae: MycrhN_5207Help
Entry
MycrhN_5207       CDS       T01685                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mrh  Mycobacterium rhodesiae
Pathway
mrh00260  Glycine, serine and threonine metabolism
mrh00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mrh01100  Metabolic pathways
mrh01110  Biosynthesis of secondary metabolites
mrh01130  Biosynthesis of antibiotics
mrh01230  Biosynthesis of amino acids
Module
mrh_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mrh00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MycrhN_5207
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MycrhN_5207
Enzymes [BR:mrh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MycrhN_5207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Gmad2
Motif
Other DBs
NCBI-ProteinID: AEV75682
UniProt: G8RXR9
Position
complement(5295951..5297210)
Genome map
AA seq 419 aa AA seqDB search
MADLAGPELPRSSAAVAEPTIHDPDERGHFGAYGGRFVPEALMAVIEEVTAAYDKARGDQ
TFLDELDRLQRHYTGRPSPMYEASRLSEHAGGARIFLKREDLNHTGSHKINNVLGQALLA
RQMGKSRVIAETGAGQHGVATATACALLGLECIVYMGAVDTARQALNVARMRLLGAEVVS
VESGSKTLKDAINEAFRDWVTNADNTYYCFGTAAGPHPFPTMVRDFQRVIGLEARAQIQA
QAGRLPDAVTACVGGGSNAIGIFHAFIDDPGTRLIGYEAAGDGVETGRHAATFAGGTPGA
FQGSFSYLLQDDDGQTIESHSISAGLDYPGVGPEHAYLKDIGRAEYRPITDTEAMDAFGL
LCRTEGIIPAIESAHAVAGALKLGSELGRDAIIVVNLSGRGDKDVETAAKWFGLMDGDS
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggccgacctagccgggccggagttgccgcgttccagtgcggccgtcgccgaacccacc
attcacgatcccgacgagcgtggccatttcggagcctacggcggacgattcgtgcccgag
gcgctcatggcggtgatcgaggaggtcaccgccgcctatgacaaagccaggggcgatcag
acatttctcgatgaactggaccgtctgcaacgccactacaccggtcgcccgtcaccgatg
tatgaggcatcgaggctttcagaacatgcgggcggagcacgaatcttcctgaaacgagaa
gaccttaaccacaccggatctcacaagatcaacaacgttctcgggcaggctctgctggcg
cggcagatgggcaagtcacgcgtcatcgccgagacgggtgcgggccagcatggtgtggcg
accgcgacggcgtgcgcgctgctgggcctggagtgcattgtctacatgggggcggtcgac
accgcgcgtcaggccttgaatgttgcgcggatgcgcctactcggtgcagaggtggtgtcc
gtcgagtccggctcgaagacgttgaaggacgcgatcaacgaagccttccgcgactgggtc
accaacgccgacaacacctactactgctttggtaccgccgctgggccccatccgtttccc
actatggtgcgcgacttccagcgagtgatcgggctcgaggcgcgcgcgcagatccaggcg
caagccggccgactgccggatgcggtgaccgcatgcgtaggtggcggatcgaacgcgatc
ggcatcttccacgctttcatcgatgatcccggcacccgcctcatcggctacgaagcagcg
ggcgatggcgttgaaactggccgtcacgcagcgactttcgcgggtggaactcctggggcg
ttccagggttcgttctcgtacctgcttcaggacgacgacgggcagacgattgaatcccat
tcgatctcagctggtttggactatcccggcgtcgggccggaacacgcgtacctgaaagac
atcggccgcgctgagtacaggccgatcaccgacaccgaggcgatggatgcgttcggattg
ttgtgccggaccgagggaatcatcccggccatcgaatcggcgcacgccgtagcgggtgcg
ctgaagctgggttccgagctcggccgtgacgcgatcatcgtggtcaatctgtcggggcgc
ggtgacaaggacgtcgagacagcggccaagtggttcgggttgatggacggtgactcgtga

DBGET integrated database retrieval system