KEGG   Mycolicibacterium rhodesiae: MycrhN_5298Help
Entry
MycrhN_5298       CDS       T01685                                 

Definition
(GenBank) 2-haloalkanoic acid dehalogenase, type II
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
mrh  Mycolicibacterium rhodesiae
Pathway
mrh00361  Chlorocyclohexane and chlorobenzene degradation
mrh00625  Chloroalkane and chloroalkene degradation
mrh01100  Metabolic pathways
mrh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mrh00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MycrhN_5298
   00361 Chlorocyclohexane and chlorobenzene degradation
    MycrhN_5298
Enzymes [BR:mrh01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     MycrhN_5298
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase HAD_2 Hydrolase_like Hydrolase_6 DUF5642 HAD
Motif
Other DBs
NCBI-ProteinID: AEV75773
UniProt: G8RYY2
Position
5387522..5388205
Genome map
AA seq 227 aa AA seqDB search
MNPAVLIFDVNETLIDIESLRPHLERILGDGDVLREWFNQLVMYSMTTTMSGAYVDFFTL
GQAVLRMVGDTRQVQVTDGDLDEFAHGMRTMPAHPDVADGLAQLRAQGHRLVTLTNSPSK
PGVPTPLENAGLAQHFDKQFSVDTWGVFKPSPQLYTGVAADLGVTPSACMMVAAHVWDTI
GAQSVGFRGALITRPGNAPLPTDALPQPDIVVSDTLELAERLLTWDR
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
gtgaacccggctgttctcatcttcgacgtcaacgagacgctgatcgacatcgaatccctg
cgaccgcatctcgagcggatcctcggcgacggcgacgtgctgcgcgaatggttcaaccag
ctcgtcatgtactcgatgacgaccaccatgtccggtgcctatgtcgacttcttcaccctc
ggacaggccgtcctgcggatggtcggtgacactcgtcaggtccaggtcaccgacggcgac
ctcgatgaattcgcacacggcatgcgcaccatgcctgcccaccccgatgtcgccgacggg
ctcgcgcagctgcgggcgcagggccatcgcctcgtcaccctgaccaattcaccgtcgaag
ccgggtgtgccgacaccgcttgagaacgccggtctggcccagcacttcgacaagcagttc
agcgtcgacacctggggtgtcttcaaaccgtctccgcagctgtatacgggcgtcgccgca
gacctcggcgtgacaccgtcggcctgcatgatggtcgccgcacacgtgtgggacaccatc
ggcgcgcagtcggtcgggttccgcggcgcgctgatcacccgccccggtaatgcgcccctg
cccactgacgcgctgcctcaaccggacatcgtcgtctcggacactctggagttggccgag
cggcttctaacttgggatcggtag

DBGET integrated database retrieval system