KEGG   Mycobacterium rhodesiae: MycrhN_5321Help
Entry
MycrhN_5321       CDS       T01685                                 

Definition
(GenBank) 6-phosphogluconolactonase
  KO
K01057  6-phosphogluconolactonase [EC:3.1.1.31]
Organism
mrh  Mycobacterium rhodesiae
Pathway
mrh00030  Pentose phosphate pathway
mrh01100  Metabolic pathways
mrh01110  Biosynthesis of secondary metabolites
mrh01120  Microbial metabolism in diverse environments
mrh01130  Biosynthesis of antibiotics
mrh01200  Carbon metabolism
Module
mrh_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
mrh_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:mrh00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MycrhN_5321
Enzymes [BR:mrh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     MycrhN_5321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucosamine_iso Sugar-bind
Motif
Other DBs
NCBI-ProteinID: AEV75796
UniProt: G8RZ05
Position
5410315..5411049
Genome map
AA seq 244 aa AA seqDB search
MSTVVEKYPDTDALVVGAGDRLVAAITGAIDKRGRALIVLTGGGTGTGLLKRVREQADGI
DWSKVHLYWGDDRFVPADDDERNEKQARQALIDHVDIPAANVHAMAPSGGEFGDDLDAAA
QAYEQVLAADADDGSIPDFDVHLLGMGGEGHINSLFPDTPAVKETSRTVIGVTDSPKPPP
RRITLTLPAVQRSREVWLVVSGEGKADAVAAAIGGANPVDVPAAGGVGREATVWLLDEAA
ASKL
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgagcactgtcgtcgagaagtacccggacacagacgctttggtggtcggtgccggagac
cggctcgtcgccgcgatcaccggggcgatcgacaagcgaggccgcgcactcatcgtgctc
accgggggcggcacagggaccgggctgctcaagcgggttcgcgaacaggccgacgggatc
gactggtcgaaggtccacttgtactggggcgacgatcgtttcgtgcctgctgacgacgac
gaacgcaacgagaaacaggcccgtcaggcgctgatcgaccacgtcgacatccctgcggcc
aatgtccatgccatggcgcccagtggcggcgagttcggagacgacctggacgcggccgcg
caagcgtacgagcaagtgcttgccgcggatgccgacgacggctcgataccggattttgac
gtccacctgctgggcatgggcggtgagggccacatcaactcgctgttcccggacacgccg
gccgtgaaggaaaccagccggacggtgatcggcgtgaccgactcccccaaaccgccgccg
cgacgaatcacgttgacgctgcccgctgtccagcggtcgcgcgaggtgtggttggtggtc
tccggtgagggcaaggccgacgcggtcgccgcggcgatcggaggcgccaaccctgtcgac
gtgcctgccgccggcggcgtcggtcgcgaagcgacggtgtggctactcgacgaggccgct
gcttccaagctctag

DBGET integrated database retrieval system