KEGG   Mycobacterium rhodesiae: MycrhN_5563Help
Entry
MycrhN_5563       CDS       T01685                                 

Definition
(GenBank) transcriptional regulator/sugar kinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
mrh  Mycobacterium rhodesiae
Pathway
mrh00010  Glycolysis / Gluconeogenesis
mrh00520  Amino sugar and nucleotide sugar metabolism
mrh01100  Metabolic pathways
mrh01110  Biosynthesis of secondary metabolites
mrh01120  Microbial metabolism in diverse environments
mrh01130  Biosynthesis of antibiotics
mrh01200  Carbon metabolism
Module
mrh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mrh_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mrh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MycrhN_5563
   00520 Amino sugar and nucleotide sugar metabolism
    MycrhN_5563
Enzymes [BR:mrh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     MycrhN_5563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AEV76032
UniProt: G8RJU1
Position
5647698..5648504
Genome map
AA seq 268 aa AA seqDB search
MSATDSPATAPDTGAGQRRGFGIDVGGSGVKGGIVDLDTGLLIGDRFKLETPQPATPEAV
SKTVAAVVREFGWTDKVGVTYPGVVTGGIVHTAANVDKSWIGSNVSEFYSKALDGQPVTV
LNDADAAGLAEERFGAGRDNTGVIVLLTFGTGIGSAVIHNGVLLPNTEFGHLEVGGKEAE
HRAASSVKEKKDWSYARWTEEVTKVLVAIENAIWPDLFIAGGGISRKAEKWVPLLKNRTP
VVAAALQNTAGIVGAAMAAEVDVTATGK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgtcagccaccgattcccccgccacagcaccggatacaggcgcgggccagcgccgcggc
ttcggcatcgatgtcggcggcagcggggtcaagggcggcatcgtcgacctcgacaccggt
ctgctgatcggcgaccgattcaagctcgagaccccccagcccgcgacgcctgaggcagtc
agcaagaccgtggccgccgtcgtccgcgaattcggttggaccgacaaggtcggggtcact
tatcccggcgtggtcaccggggggatcgtgcacaccgcggccaacgtcgacaagagctgg
atcggcagcaatgtcagcgagttctacagcaaggcgctcgacggacagccggtcaccgtg
ctcaacgacgccgacgcggccgggctggccgaggagaggttcggcgcaggtagggacaac
accggcgtcatcgtgctgctgacgttcggcaccggtatcggttccgcggtgatccacaac
ggcgtgctgctgcccaacaccgagttcggccacctcgaggtgggcggcaaggaagccgag
catcgcgcggcgtcctcggtcaaggagaagaaggactggagctacgcgcgctggaccgag
gaagtgacgaaggtgctggtggcgatcgagaatgccatctggccagacctgttcatcgcc
ggcggcggtatcagccgtaaagccgagaagtgggtcccgctgttgaagaaccgcacgccc
gtcgtggccgcggctctgcagaacaccgcgggcatcgtcggcgccgcgatggccgctgag
gtcgacgtcacagctactggcaagtag

DBGET integrated database retrieval system