KEGG   Maioricimonas rarisocia: Mal4_30510
Entry
Mal4_30510        CDS       T06940                                 

Gene name
xdhA_2
Definition
(GenBank) Xanthine dehydrogenase molybdenum-binding subunit
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
mri  Maioricimonas rarisocia
Pathway
mri00230  Purine metabolism
mri01100  Metabolic pathways
mri01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mri00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Mal4_30510 (xdhA_2)
Enzymes [BR:mri01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     Mal4_30510 (xdhA_2)
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: QDU38721
UniProt: A0A517Z8F9
Position
complement(4026157..4028439)
AA seq 760 aa
MATVEQTPDTSRKYNVIGTRPVRHDGVDKVTGRARYGADIKLTGQLEGFILRSPHAHARI
RSIDVSDAEKVPGVRAIVTNADLPDPGDRVAELGEGAVNMKHLATNVLAKDRVLYRGHAV
AAVAADNRHIAEEAARLIKVEYEKLPPVLDVREAMSDEAPRLHDDIYTKEMGEAVTETPS
NVAQRICHEKGDVDKGFAEADLVIEREFRTATVHQGYIEPHTSTALWNADDHITIWTSTQ
GTFTVRQQCAELVGVPVSNIRVVPMEIGGGFGGKISVYEQPVAAMLSKKSGRPVRVTMDR
TDVLEATGPTPGSYIRVKLGVTKDGRLTAGEAWMAYEAGAYPGSPIGAGSMCIFACYDIP
AGRVEGFDVCVNKPRTNAYRAPGSTNAAFAVETVIEEICEKLGICPLEFRMQNAAKEGTR
RIDGYRFPRIGLYETLEAVKNSEHWNTPLEGPNRGRGVASGFWFNAGLKSSVTVTVNADG
KVSLIEGSTDIGGTRTSIAMQLAETLGIPVEDVNPSVVDTDSVGYTDVTGGSRVTLATGL
AAYEAGLKIRDQFCQHAARIWGVTTEEVEYEDGGVSGPDGKRFEFGELADRIQKSGEPVT
ASTSVTAPASSNAFGTHCVDVEVDPDLGKVTILRYTAVQDAGTAIHPAYVEGQMQGGAAQ
GIGWALNEEYFYDAEGNLRNSSLLDYRMPTCFDLPMIDTIIVEVPNPDHPYGVRGVGEVP
ICPPPAAIGAAIANAVGVRMHELPMSPPRLLHEILAKRNA
NT seq 2283 nt   +upstreamnt  +downstreamnt
atggcgaccgtcgagcagacccccgacacctcccgcaagtacaacgtcatcggcacccga
cctgtccggcacgacggtgtcgacaaggtcacggggcgggcccgatacggggccgacatc
aagctgaccggtcagctcgagggcttcatcctgcgcagcccgcacgcacatgcccgcatc
cgctcgatcgacgtctccgacgcggagaaagtccccggcgtccgtgcgatcgtcaccaat
gccgacctgcccgatcccggtgaccgcgttgccgaactgggggaaggggcggtcaacatg
aagcatctggccacgaacgtcctcgcgaaggatcgcgtgctttaccgtggccatgcggtt
gccgcggtggccgccgacaaccgtcacatcgccgaagaagccgcccggctgatcaaagtc
gagtacgagaaactccctcccgttctcgacgtgcgggaagcgatgtccgacgaggcgccc
cggctgcatgacgacatttatacgaaggagatgggtgaggcggtcaccgagacccccagc
aatgtcgcgcagcggatctgccacgagaagggagacgtcgacaagggattcgccgaagcc
gatctggtcatcgaacgcgagttccggacggccacggtccaccagggctacatcgagccg
catacctcaacggccctctggaacgccgacgaccacatcaccatctggaccagcacgcag
gggaccttcacggttcgtcagcagtgtgccgaactcgtcggtgtcccggtcagcaacatc
cgcgtcgtgccgatggaaatcggcggcggatttggcggcaagatttcggtctacgagcag
ccggtcgcggcaatgctctccaagaagtccggtcgtcccgtccgtgtcaccatggaccgg
accgacgtcctcgaagcgaccggcccgacgcccggttcctacatccgcgtcaagcttggc
gtcacgaaggacggtcgcctgaccgccggcgaagcatggatggcgtacgaagccggagcc
tatcccggttcgccgatcggggccggctccatgtgcatcttcgcctgctacgacatcccg
gccggccgggtcgaaggcttcgacgtctgcgtcaacaagccccgcacaaatgcctaccgt
gctcccggatcgacgaacgcggcattcgcggtcgagaccgtgatcgaggagatctgtgag
aagctcggcatctgcccgctcgagttccgtatgcagaatgctgcgaaagagggaacccgc
cgcatcgacgggtacaggttcccccgcatcgggctctacgaaacgctcgaagcggtcaag
aactcggaacactggaacacgccgctcgaaggtcccaatcgcggtcgcggcgtcgcctcc
ggattctggttcaacgccgggctgaagtcttcggtcaccgtgaccgtcaatgctgacggc
aaggtctcgctgatcgaaggctcgaccgacatcggcggcacccggaccagcatcgcgatg
cagctcgccgagacgctcggcatcccggtggaagacgtcaatccctcagtcgtcgatacc
gacagcgtcggctacaccgacgtcaccgggggcagtcgcgtcaccttggccaccggcctg
gctgcctacgaagccggcctgaagatccgcgatcagttctgccagcacgccgcccgcatc
tggggcgtcacgaccgaagaggtcgagtacgaagacggcggcgtcagcggaccggacggc
aagcggttcgagtttggcgaactggccgaccgcatccagaaatcgggcgaaccggtcact
gcgtccacgagtgtcaccgcccctgcttcgagcaatgcgttcggcacccactgtgtggac
gtcgaggtcgatccggacctcggcaaggtgaccattctgcggtacaccgctgtgcaggac
gccggcaccgccattcatcccgcatacgtcgaaggacagatgcagggaggagccgcccag
gggattggctgggccctcaacgaagagtacttctatgacgccgagggaaacctgcggaac
agcagcctcctcgattaccgcatgcccacctgtttcgacctgccgatgatcgacacgatc
atcgtcgaagtgccgaatccggatcatccgtacggagtccgcggcgtgggtgaggtgccg
atctgtccaccgcctgccgccatcggtgcggcgatcgccaatgcggtcggcgtccgcatg
cacgaactgccgatgtcgccgccgcgcctgctgcacgagattctcgccaaacggaacgcg
tga

DBGET integrated database retrieval system