KEGG   Minicystis rosea: A7982_00677
Entry
A7982_00677       CDS       T04613                                 

Definition
(GenBank) Delta(24(24(1)))-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
mrm  Minicystis rosea
Pathway
mrm00100  Steroid biosynthesis
mrm01100  Metabolic pathways
mrm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mrm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    A7982_00677
Enzymes [BR:mrm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     A7982_00677
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 DUF2567 DUF4229
Other DBs
NCBI-ProteinID: APR75331
UniProt: A0A1L6L0R2
Position
complement(745965..747065)
AA seq 366 aa
MSTNISALDPAGLAAGAAIFFGFVGALFIASRIVPGKREPGVPLEDGSRVTYTLNGFRLF
LVVTAVTAAIALLRPAALAAVHTHFWPIFAVANVTAFSFSIYLTLRGRKREGRSRPGVIG
FVVDTFYGVELNPTIAGVDLKMFSYRPSLMGLGLLNISFAAAQYHELGYITTRMWVYQTF
YFIYLCNYFQFEYGMIYTWDIIAERFGWMLVWGDYVLVPFFYSIPGWYLLHDTDPMPVWQ
VVALGVLYVIGFVLFRGSNEQKHQFKADPNRPIWGKRPEALGGKLLVSGFWGIGRKLNYT
GELLMYIAWSATTGTQSLVPYLLPLWLSILFPHRAFRDDQRCRAKYGDLWEAYCRRARFR
MIPFLY
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgagcaccaacatctctgctctggatcccgccggcctcgccgccggcgcggccatcttc
ttcggcttcgtgggcgcgctcttcatcgcgtcgcgcatcgtgcctggcaagcgggagccg
ggggtcccgctcgaggacgggagccgcgtcacgtacacgttgaacggcttccgtctcttc
ctcgtcgtcaccgccgtcacggccgccatcgccttgctgcgccccgccgcgctcgccgcg
gtgcacacgcatttctggccgatcttcgccgtggccaacgtgacggccttctcgttctcg
atctacctcacgctccgcggccgcaagcgcgaaggccgatcgcgccccggcgtcatcggc
ttcgtcgtcgacaccttctatggagtcgagctcaaccccaccatcgccggcgtcgatctc
aagatgttctcctaccggccctcgctcatgggcctcggtctgctcaacatctcgttcgcc
gccgcgcagtatcacgagctcggctacatcacgacgcggatgtgggtttatcaaaccttc
tacttcatctacctctgcaactacttccagttcgaatacggcatgatctacacctgggac
atcatcgccgagcgcttcggctggatgttggtctggggagattacgtgttggtgccgttc
ttctacagcatccccggctggtacctgctccacgacaccgatcccatgcccgtttggcag
gtggtggccctcggcgtgctctacgtgattggtttcgtcctcttccgtggctcgaacgag
caaaagcatcaattcaaggccgatcccaaccgcccgatctggggaaagcgccccgaggcc
ctgggcggcaagctgctcgtttcgggcttctggggcatcggccgcaagctcaattacacg
ggcgagctcctcatgtacatcgcttggagcgcgaccacgggcacgcaatcgctcgtgcct
tatctcctcccgctctggctctccatcctgtttcctcaccgcgccttccgcgacgatcag
cgctgccgcgccaagtatggtgatctctgggaagcctattgccggcgcgcacgcttccgg
atgatcccgtttctgtattga

DBGET integrated database retrieval system