KEGG   Minicystis rosea: A7982_00830Help
Entry
A7982_00830       CDS       T04613                                 

Definition
(GenBank) Maleylacetoacetate isomerase
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
mrm  Minicystis rosea
Pathway
mrm00350  Tyrosine metabolism
mrm00643  Styrene degradation
mrm01100  Metabolic pathways
mrm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mrm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    A7982_00830
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    A7982_00830
Enzymes [BR:mrm01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     A7982_00830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C_5 GST_C_2 GST_C Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: APR75484
UniProt: A0A1L6L157
Position
924884..925561
Genome map
AA seq 225 aa AA seqDB search
MHRLPCLAMDTTLYQYWRSSASWRVRWALAIKGIPFSTVPVNIVAGEQLTDEHRARNPMG
HVPALWIDGRCFAESVAILEYLEETRPTPTLYPRDPWARARVRQVVELINSGIQPLQNLV
VLGRHTKDPDEKTNWARFFNERGLAACEALVSTIASEIPGDGNYCVGSSLTAADLFVIPQ
LATARRFGVDLARFPRLLAVETAVLATPHAASALPEKQPGAPASA
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
gtgcaccgattaccgtgcctcgcgatggacacgaccctctaccaatattggcgctcctcg
gcctcgtggcgcgtgcggtgggcgctcgcgatcaaaggcatcccgttcagcacggtgccg
gtgaacatcgtcgccggcgagcagctcacggacgagcaccgggcgcgcaaccccatgggg
cacgtgcccgcgctgtggatcgatgggcgctgcttcgccgagtcggtggccatcctcgaa
tatctcgaagagacgcggcccacgcccacgctctacccgcgggatccgtgggcgcgcgcg
cgggtgcggcaggtggtggagctcatcaactcgggcattcagccgctgcagaacttggtc
gtgctcgggcgccacacgaaggatcccgacgagaagaccaactgggcccgcttcttcaac
gagcgcggcctcgccgcgtgcgaggcgctcgtctccaccatcgcctccgagatccccggc
gatggcaactactgtgtggggtcgagcttgacggcggccgatctcttcgtgattccccag
ctcgccaccgcgcgccgcttcggtgtggacctcgcgcgttttccgcggctcctcgccgtc
gagacggcggtgctcgccaccccgcacgcggcgtcggcgctccccgagaagcagccgggc
gcgcccgcgtcggcgtag

DBGET integrated database retrieval system