KEGG   Minicystis rosea: A7982_02566Help
Entry
A7982_02566       CDS       T04613                                 

Definition
(GenBank) 5-nucleotidase SurE
  KO
K03787  5'-nucleotidase [EC:3.1.3.5]
Organism
mrm  Minicystis rosea
Pathway
mrm00230  Purine metabolism
mrm00240  Pyrimidine metabolism
mrm00760  Nicotinate and nicotinamide metabolism
mrm01100  Metabolic pathways
mrm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mrm00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    A7982_02566
   00240 Pyrimidine metabolism
    A7982_02566
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    A7982_02566
Enzymes [BR:mrm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     A7982_02566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SurE
Motif
Other DBs
NCBI-ProteinID: APR77219
UniProt: A0A1L6L609
Position
complement(2925264..2926037)
Genome map
AA seq 257 aa AA seqDB search
MADRPLILLSNDDGVLAPNLTAMREALAEHADVVVCAPELNQSATSHSLSLHRILRLREV
SSGVFGLDGTPADCVYVALHSGTRVLPRRPDLVVSGMNHGLNLGVDVFYSGTVAAAREAA
LRGLPSIAVSADSGADRVAAARLGAQLALGALAAFRRAPGPRAPLLNVNIPPGDRWPVRA
TRLGARLYSEDVDYRRDPRGREYLWIGGAGEVRHDLVPGSDTEAYDEGAASVTPLSLDLW
AADQSVLAAEVAGAVTR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
gtggctgaccgtcctctcatcctcctctccaacgacgacggcgtcctcgcgcccaatttg
acggcgatgcgcgaggcgctcgccgagcatgcggacgtcgtcgtgtgtgcgcccgagctc
aaccagagcgcgaccagccactcgctctcgctgcatcggatcctgcgtctgcgtgaggtt
tcgagcggcgtgttcgggctcgatgggacgccggccgactgcgtgtacgtcgcgctccac
tcaggcacgcgcgtgcttccgcgccggcccgatctggtggtctcggggatgaaccacggg
ctgaacctgggcgtcgacgtgttctattcgggcaccgtcgccgccgcgcgcgaagcggcg
ttgcgaggcttgccgtcgatcgcggtgtcggccgacagcggtgcggatcgcgtcgcggcg
gcgcggctcggcgcgcagctcgcgctcggtgcgttggctgcgtttcggcgcgcgccgggg
ccgcgggcgccgctgctcaacgtgaacattccacccggcgatcgatggccggttcgagcc
acgcggctcggcgcgcggctctactcggaggacgtcgactaccggcgcgatccgcgcggt
cgcgaatacctgtggatcggtggagccggcgaagtgcggcacgatctcgtccccggctcc
gataccgaggcgtacgacgagggcgcggccagcgtgacgccgttgtcgctcgatctctgg
gccgccgatcaaagcgtgttggctgcggaggtcgcgggcgcggtgacgcgctga

DBGET integrated database retrieval system