KEGG   Minicystis rosea: A7982_03834Help
Entry
A7982_03834       CDS       T04613                                 

Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
mrm  Minicystis rosea
Pathway
mrm00450  Selenocompound metabolism
mrm00970  Aminoacyl-tRNA biosynthesis
mrm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mrm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    A7982_03834
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    A7982_03834
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mrm01007]
    A7982_03834
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mrm03016]
    A7982_03834
Enzymes [BR:mrm01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     A7982_03834
Amino acid related enzymes [BR:mrm01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   A7982_03834
Transfer RNA biogenesis [BR:mrm03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    A7982_03834
 Prokaryotic type
   Other AARSs
    A7982_03834
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e Anticodon_1 Transposase_28
Motif
Other DBs
NCBI-ProteinID: APR78487
UniProt: A0A1L6L9N7
Position
4492214..4494232
Genome map
AA seq 672 aa AA seqDB search
MGSRFYVTTPIYYINDVPHLGSAYTTIAADVLARYHRLRGDETRFLTGTDEHGLKIQRAA
AERGVPPQAFADDISSKFRETWPKLDCAFDDFIRTTEPRHKGAVQDLWRTIRDTKNKPEP
NIYLGHYEGLYCVSCEAYYTEKDLEQPGNICPQHKKPVEMLKEESYFFRLSAYADELLAY
YESHPDFVQPPGRFNEVKSFVQAGLQDLSISRTTFQWGIPVPDDPRHVMFVWFDALTNYR
SALLKPENREHLWPSAVHLVGKDILRFHAVYWPAFLLAAGLPLPKHVFAHGFLTYNGLKM
SKTLRNTVSPVALAQALSPKFGTDVVRYCLMRAISFGQDGDFSIHDVLQRYSSELANTLG
NLLNRVLPFAREGLPRGEAGELEKGLMDAYPVAAKAVSEAFDELDPTRALNALWGLLGKA
NEYIDKAAPWAAKKKGDTVRLGAIVATLLDVLEAVSVLVAPVLPTVANEMRRQLGLVPLD
WEALAKEPKAFWPLALPTRPDGIAVVAASESAPIFPKFEKEREAEIIKEFTPSVPAPEPA
AEPQKPAAEAKKAEAAPAPREAKGTITFDDFGKLDIRIGLITSAERVKKKDKLLDLRVDT
GDAAPRRIVAGIASAYAPEALVGKRVAVLCNLAPRDFGKGLVSEGMILAAEDGNGLAVLT
PDREKVPGSPVQ
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgggcagccggttctacgtcaccaccccgatctactacatcaacgacgtccctcacctg
gggagcgcgtacaccacgatcgccgccgacgtgctcgcgcgctaccaccggctgcgcggt
gacgagacccgcttcctcacggggacggacgagcacggcctcaagatccaacgcgcggcg
gccgagcgcggcgtgccgccgcaggccttcgccgacgacatctccagcaagttccgcgag
acgtggccgaagctcgactgcgccttcgacgacttcatccgcaccaccgagccgcgccac
aagggcgccgtccaggacctgtggcggaccatccgcgacacgaagaacaagcccgagccc
aacatctaccttgggcactacgaggggctctactgcgtctcgtgcgaggcctactacacc
gagaaggacctcgagcagccgggcaacatctgcccgcagcacaagaagccggtcgagatg
ctcaaggaggagagctatttcttccgcctctccgcctacgccgacgagctcctcgcttac
tacgagagccacccggatttcgtgcagccgcccggccgcttcaacgaggtgaagagcttc
gtgcaggcgggtttgcaggatctctcgatctcccgcaccacgttccagtgggggatcccc
gtgcccgacgatccgcggcacgtgatgttcgtgtggttcgacgcgctcaccaattatcgg
agcgcgctgctcaagccggagaacagagagcacctctggccgagcgccgtgcacctcgtg
ggcaaggacatcctccgcttccacgcggtgtattggccggcgttcctcctggctgcgggg
ctgccgctgccgaagcacgtcttcgcgcacgggttcctcacgtacaacgggctcaagatg
tcgaagacgctgcgcaacacggtgagccccgtggcgctcgcgcaggcgctctcgccgaag
ttcggcaccgacgtggtccgttattgcctgatgcgcgccatctccttcgggcaggatggt
gacttcagcattcatgacgtgctccagcggtattcgtcggagctcgccaacacgctgggg
aacctgctcaatcgcgtgctgcccttcgcgcgcgaggggctcccgcgcggcgaagcgggc
gagctggagaagggtttgatggatgcctatccggtcgccgcaaaggccgtgtcggaggcc
ttcgacgagctcgacccgacgcgggcgctcaacgcgctctggggtctgctcgggaaggcc
aacgagtacatcgacaaggcggcgccgtgggcggcgaagaagaagggcgacacggtgcgg
ctcggcgccatcgtggctacgctcctcgacgtgctcgaggccgtgagcgtcctcgtcgcg
ccggtgctgccgacggtggccaacgagatgcggcgtcagctcggtctcgtgcccctcgat
tgggaggcgctcgcgaaggagccgaaggcgttctggccgctcgcgttgcccacgcgtccc
gacgggatcgcagtggtcgctgcctcggagagcgcgcccatcttcccgaagttcgagaag
gagcgcgaggcggagatcatcaaggagttcacgccttcggtgcccgcgccggagccggcc
gcggagccgcagaagccggcggccgaagcgaagaaggccgaggccgcgcccgcgccgcgc
gaggcgaaggggacgatcaccttcgacgatttcgggaagctcgacatccgcatcgggctc
atcacgtcggccgagcgcgtgaagaagaaggacaagctcctcgatctgcgcgtcgacacc
ggcgacgcggccccgcggcgcatcgtggccggcatcgccagcgcgtacgcgccggaggcg
ctcgtcggcaagcgcgtggccgtgctctgcaatctggcgccccgcgatttcggcaagggg
ctcgtgtcggaggggatgatcctcgccgcggaggatgggaacggcctcgcggtgctcact
ccggaccgcgaaaaagtgcccggctcgccggtgcaatga

DBGET integrated database retrieval system