KEGG   Minicystis rosea: A7982_08553Help
Entry
A7982_08553       CDS       T04613                                 

Definition
(GenBank) Glutathione peroxidase family protein
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
mrm  Minicystis rosea
Pathway
mrm00480  Glutathione metabolism
mrm00590  Arachidonic acid metabolism
mrm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mrm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    A7982_08553
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    A7982_08553
Enzymes [BR:mrm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     A7982_08553
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: APR83204
UniProt: A0A1L6LN38
Position
complement(9802271..9802822)
Genome map
AA seq 183 aa AA seqDB search
MTTALEQIPVQTIDGKPSSLGAYAGKVRLIVNVASKCGLTPQYTALEAAYRKYKDRGFEI
LAFPANEFGAQEPGTNEEIQSFCSTQYDVSFPLFAKIVVKGEGQHPLYASLTAAKPEART
LPGVDFRGKLIGYGIVPGAPDEILWNFEKFLVDRNGEVIERFSPDMGPDSEPVVAAIERA
LAG
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgccctcgaacagatccccgtgcaaaccatcgatggaaaaccctcctcgctc
ggcgcgtacgccggcaaggtgcgcctcatcgtcaacgtcgcttcgaaatgcggcctcacg
ccccaatacaccgcgctcgaggcggcctatcgcaaatacaaggatcgcggcttcgagatc
ctcgccttccccgccaacgagttcggcgcgcaggagccgggcaccaacgaagagatccaa
tccttctgctcgacccaatacgacgtctcgttcccgctcttcgccaaaatcgtggtgaag
ggcgaaggccaacacccgctctacgcgagcctcaccgcggccaagcccgaagcccgcacg
ctccccggcgtggacttccgcggcaagctcatcggctacggcatcgtgcccggcgcgccc
gacgagatcctctggaacttcgagaaattcctcgtcgatcgcaacggcgaggtcatcgag
cgcttctctcccgacatgggcccggacagcgagccggtcgtcgcggccatcgagcgcgcg
ctcgcgggctga

DBGET integrated database retrieval system