KEGG   Minicystis rosea: A7982_12235Help
Entry
A7982_12235       CDS       T04613                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mrm  Minicystis rosea
Pathway
mrm00071  Fatty acid degradation
mrm00072  Synthesis and degradation of ketone bodies
mrm00280  Valine, leucine and isoleucine degradation
mrm00310  Lysine degradation
mrm00362  Benzoate degradation
mrm00380  Tryptophan metabolism
mrm00620  Pyruvate metabolism
mrm00630  Glyoxylate and dicarboxylate metabolism
mrm00640  Propanoate metabolism
mrm00650  Butanoate metabolism
mrm00900  Terpenoid backbone biosynthesis
mrm01100  Metabolic pathways
mrm01110  Biosynthesis of secondary metabolites
mrm01120  Microbial metabolism in diverse environments
mrm01130  Biosynthesis of antibiotics
mrm01200  Carbon metabolism
mrm01212  Fatty acid metabolism
mrm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mrm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A7982_12235
   00630 Glyoxylate and dicarboxylate metabolism
    A7982_12235
   00640 Propanoate metabolism
    A7982_12235
   00650 Butanoate metabolism
    A7982_12235
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A7982_12235
   00072 Synthesis and degradation of ketone bodies
    A7982_12235
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A7982_12235
   00310 Lysine degradation
    A7982_12235
   00380 Tryptophan metabolism
    A7982_12235
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A7982_12235
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A7982_12235
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A7982_12235
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mrm04147]
    A7982_12235
Enzymes [BR:mrm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A7982_12235
Exosome [BR:mrm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A7982_12235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: APR86886
UniProt: A0A1L6LYR7
Position
13986125..13987360
Genome map
AA seq 411 aa AA seqDB search
MTTAYVIDAVRTPRGRGKLGKGALSHIHPQELFAQVLNGLQQRVGFDAREVDDVMAGIVS
QVGEQGANLARNAVLAAGWPNEVSAVSLNRFCGSGLQAIHFGAMGVASGAMSLAVAGGVE
SMSRVPMGSDGGGQDGGNEHLRERVFQVPQGISADLIATLEGISREEVDAFALRSQRNAA
RAIEEGRFAKSLLAVRDPRTGVTVLDREEFPRPDTTAEALAALKPSFVTLGQTVAGPNGE
TLDQIALRGYPQAREVRHVHTAGNSSGIVDGAGAVVLASERYVRDRGLTPRARIRAMTTI
GSEPVLMLTAPAPASEKALRIAGMKASDIDLWEINEAFAGVVIQVTRALGIDPERVNVNG
GSIALGHPLGATGAMLFGTALDELERTGKQTALVTMCIGGGQGIATILERV
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgcatatgtcatcgacgccgtccggaccccgcgtggccgcggcaagctgggg
aaaggcgcgctctcgcacatccatccgcaggagctcttcgcgcaggtgctgaacggtttg
cagcagcgcgtcggcttcgatgcgcgcgaggtggacgacgtgatggcgggcatcgtctcg
caggtcggcgagcagggggccaacctggcgcgcaacgcggtgctcgccgccggatggccc
aacgaggtgtccgcggtgtcgctcaaccgcttctgtgggtcgggcctccaggccattcac
ttcggcgccatgggcgtggcctcgggcgcgatgagcctcgccgtcgcgggcggtgtggag
agcatgtcccgcgtccccatgggctcggacggcggcggtcaggacggcggcaacgagcac
cttcgggagcgcgtcttccaggtgcctcagggcatcagcgccgatctcatcgccacgctc
gaagggatctcgcgtgaagaggtcgacgccttcgcccttcgatcgcagaggaacgcggcc
cgcgccatcgaagaaggccgcttcgccaagtcgctgctcgctgtgcgcgatccgcggacg
ggcgtgaccgtgctcgatcgcgaggagttccctcggcccgacaccacggccgaagcgctc
gctgcgctcaagccttcgttcgtcacgttgggtcagaccgtcgcgggccccaacggcgag
acgctcgatcagatcgcgctccgcgggtatccgcaggcgcgcgaggtgcggcacgtccac
accgcgggcaactcgagcggcatcgtcgacggcgcgggcgccgtcgtgctcgcgtcggag
cgctacgttcgcgaccgaggcctcacgccgcgcgcgcgcatccgcgccatgacgaccatc
ggcagcgagcccgtcctcatgctcacggcgcccgcgcccgcgagcgagaaggcgctgcgc
atcgccgggatgaaggcttcggacatcgatctctgggagatcaacgaggcgttcgccggc
gtggtgatccaggtgacgcgcgcgctgggcatcgatccggagcgcgtgaacgtgaacggc
ggatccatcgcgctcggtcacccgctcggcgcgacgggcgccatgctcttcggcaccgcg
ctcgacgagctggagcgcaccggcaagcaaaccgcgctcgtgacgatgtgcatcggcggc
ggtcagggcatcgccacgatcctcgagcgcgtttga

DBGET integrated database retrieval system